Are you looking for help finding an article or author featured in Woodcarving Illustrated? Use the search bar below to search the Fox Chapel Publishing database of Woodcarving Illustrated articles by keyword.

If you have any difficulty finding a particular article, please do not hesitate to call our knowledgeable customer service representatives at 888-506-6630 or send them an email.

TitleDescriptionContributor #1Contributor #2Contributor #3Issue #IssueYearPageSubject 1Subject 2Subject 3Subject 4Subject 5Link to Buy it Now
The Five Most Common Sharpening Mistakes and Their SolutionJohn Mignone is a classical musician, a tree propagator, and a professional woodcarver.Mignone, John1Christmas199714-19SharpeningToolsSafetyKnives
Carving Santa and RudolphCarving the piece featured on this issue's cover.Sabol, David1Christmas199722-28SantasHolidaysPattern ProfileProjects, Step by Step
How-To Carve and Paint a Shorebird Stick DecoyElmer Crowell-Style Golden PloverPoeschel, Dennis1Christmas199729-36DecoysBirdsPattern ProfileProjects, Step by Step
Carving House Sign Numbers with Greg KrocktaCarving a custom name tag.Schroeder, Roger1Christmas199740-45Book ExcerptsSignsHome Decor
What's in a Name?Carving Your Own Custom Name TagHull, Joel1Christmas199748-53Name TagsCustomTechnique
Jim Hazeley's Snowy OwlBefore you begin, know your bird.Stellhorn, Ayleen1Christmas199754-55BirdsOwlsAvian
The 1998 World Woodcarving Club ChampionshipSome photographs of the winners.WCI Staff1Christmas199757ChampionshipsWinnersCarving Club
Relief Carving: Row BoatWorld-Class Carver, David Bennett, explians basic principles with a handsome small project.Bennett, David1Christmas199758-62Relief CarvingBoatArtist Profile
Bob Hand on Carving & Painting a Striped Bass10'' is the size that Bob Hand has found popular with buyers - ''shelf size'' as he calls it.Schroeder, Roger1Christmas199764-67FishBassFishing
Ozarks Meeting PlaceExploring Carving in BransonGiagnocavo, Alan1Christmas199768-70Travel TipsMidwestAdventure
Carving the Caricature Carvers of America CircusWe catch up with the Caricature Carvers of America.WCI Staff1Christmas199771Book ExcerptsCircusCCA
Going to the DogsThe perfect beginner project plus detailed pattern!Guldan, Mary Duke1Christmas19977/11/2007Book ExcerptsAnimalsDogs
Promoting Carving with the Caricature Carvers of AmericaCCA book excerpts.WCI Staff1Christmas199773-74CCABook ExcerptArtist Profile
Power Texturing Wood Carvings - Part 1Texturing fur & hair.Russell, Frank1Christmas199775-82TexturesFurHair
Color Theory for WoodcarversDesiree Hajny is a wildlife artist and cartoonist from Eckert, Colorado.Hajny, Desiree1Christmas199784-87AnimalsLionPainting Techniques
Harold EnlowA 25 year tour with your favorite caricature carver.Stellhorn, Ayleen1Christmas199789-93PeopleCaricaturesArtist Profile
Hanging Spiral Santa OrnamentPattern for a unique spiral Santa ornament!Oar, Ross1Christmas199794-95SantasHolidaysOrnaments
The Ward World ChampionshipThe World at a glance.WCI Staff2Winter/Spring199816-19ChampionshipsWinnersWard Worldhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Carousel Art: The Empire State CarouselRoger Schroder visits this ambitious project.Schroeder, Roger2Winter/Spring199820-23Carousel AnimalsNYCAnimalshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Cardinal Carving - Part 1 - Carving the BirdCarve the gorgeous bird featured on our cover.Doherty, Paul2Winter/Spring199824-35BirdsStep-by-stepCardinalhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Carving the Uncommon BottlestopperA Terrific project to every carver.Stellhorn, Ayleen2Winter/Spring199836-39MiscellaneousBottlestoppersCaricatureshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Cutting CornersHave a knife and a gouge? You're ready to carve this caricature!Hull, Joel2Winter/Spring199840-45PeopleHunterCaricatureshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Bellflowers and BeadsMaking any kind of a reproduction is a challenge.Clarkson, Ron2Winter/Spring199846-49Book ExcerptsFurnitureFloralhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Cane CornerHershal Borders: Canes With A ThemeStellhorn, Ayleen2Winter/Spring199850-53CanesWalking SticksPracticalhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Desiree Hajny: A Life In TransitionAn overview of our very own Contributing Editor's work and recognition in the fine art market.Hajny, Desiree2Winter/Spring199854-59PeopleAnimalsArtist Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Carving Facial ExpressionsAn excerpt from Ian Norbury's new book.Norbury, Ian2Winter/Spring199865-69Book ExcerptsFacesRealistichttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Carving Pattern: Mountain LionBeauty and gracefulness hardly describes this hunter of the wilds.Lehman, George2Winter/Spring199870-71Book ExcerptsAnimalsMountain lionPattern Profileshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Cottonwood SpiritsAll About Cottonwood.Buchanan, Joyce2Winter/Spring199872-73Bark CarvingMiscellaneousWood Spiritshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Carving a Hummingbird PinBetter known for their highly detailed bird carvings, Chuck Solomon & Dave Hamilton present a simple pattern to get you started.Solomon, CharlesHamilton, David2Winter/Spring199874-77PinsBirdsStep by Stephttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
The Chess MuseumCCA member, Dave Stetson, appraises the techniques of the old-time masters for today's carvers.Schroeder, Roger2Winter/Spring199878-81MuseumsChessArtist Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Learning From The MastersA bear, two deer, a St. Bernard, and an owl.Stetson, Dave2Winter/Spring199882-86AnimalsWoodlandCreatureshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-2-winter-spring-1998.html
Carving a Folk FishMike Yanelli is building a strong reputation as a folk artist.Yanelli, Mike3Summer199815-20FishTroutStep by Step
Saint-Jean Port-Joli: Quebec's Carving CapitalExplore the rich carving history of this small Canadian town.Schroeder, Roger3Summer199821-25In-the-roundCanada Scenic
Carving and Painting a Realistic Daffodil with Dave SabolDavid brings a daffodil out of a piece of freshly cut white pine.Sabol, David3Summer199826-31FlowersRealistic Summer
Remembering TangeElmer J Tangerman, a tribute to the visionary of popular woodworking.Schroeder, Roger3Summer199832-34PeopleTributeArtist Profile
How to Carve EyesThe basics to carving an eye are one thing, but making the eye interact with all that the face must do to create expression requires knowledge of the entire face.Russell, Frank C3Summer199836-40EyesPeopleRealistic
Golfer PatternCarver profiles and pattern referenced for intermediate carvers. Meet Bill Howrilla, caricature cartoonist and carver and he'll show you how to make his whimsical golfer.Howrilla, Bill3Summer199841-43Pattern ProfilesGolfPeopleCaricatures
Cane CornerIn stride with the American National Cane Club.WCI Staff3Summer199844-45CanesWalking SticksArtist Profile
Painting the Cardinal - Part 2 in a SeriesIn the first part of this article (Winter/Spring 1998) I showed you how to carve a cardinal from start to finish. Now, I'll show you the tips and techniques I use to paint my cardinal carvings.Doherty, Paul3Summer199846-52Painting TechniquesBirdsCardinal
Cover Feature: Portraits in WoodCarver Armand LaMontange: A look into this carver's gallery of life-sized celebrity replicas.Schroeder, Roger3Summer199853-60PeopleRealistic FiguresTechnique
A Chip Carving PrimerRoger Nancoz's definitive step-by-step guide to getting started in chip carving.Nancoz, Roger3Summer199866-75Chip CarvingStep-by-stepArtist Profile
Learning from the Master - Part 2Dave Stetson, president of the Caricature Carvers of America, puts a critical eye to four carvings.Stetson, Dave3Summer199876-79AnimalsPeopleArtist Profile
Carving Fish HeadsEd Walicki shows you how how to achieve a detailed head (without using your own).Walicki, Ed3Summer199880-87FishRealisticFishing
Eagle PortraitThe Eagle, excerpt from Bill Hudt's new book.Judt, Bill (W.F.)3Summer199889-92Relief CarvingBirdsAvian
Artistry in Wood''Everything under the sun'' woodworking show.WCI Staff4Fall199844-45Artistry in WoodCarving ShowHighlights
Carving Contest ManiaExciting to enter and win!WCI Staff4Fall199814ContestsRulesRegulations
Creating Mood with Texture and ColorDesiree Hajny examines the art of creating expressions.Hajny, Desiree4Fall199817-19PeopleFurTexture
The Thrill of the WardCheck out what it takes to be a World Winner.WCI Staff4Fall199822-27ChampionshipsWinnersWard World
Cane CornerCarve your own Hobo Bidlestiff, complete with pattern and authentic RR logos.Maxwell, Jim4Fall199829-32Pattern ProfilesRailroad LogosCanesHobos
A Sharper EdgeTips from a professional sharpener.Yorburg, Bob4Fall199834-37SharpeningToolsSafety
On the RoadNew Feature: Spot an UNUSUAl carving while taking that family road trip? Snap a photo and send it to us with an accompanying description. Perhaps we'll publish it to share with your fellow carvers!WCI Staff4Fall199838On The RoadArtist ProfileTips
Carving a GhostNo tricks! Ivan Whillock's easy-to-carve pattern turns this costumed ''ghoul'' into a treat for any Halloween.Whillock, Ivan4Fall199840-41HolidaysHalloweenGhostPattern Profiles
How to Carve a Deer Relief Peg RackDave Sabol shows you how to make this attractive peg rack.Sabol, David4Fall199844-55Step by StepPattern ProfilesRelief CarvingAnimalsDeer
Carving SpoonsThey're not just for serving food anymore. Excerpts from Shirley Adler's book on decorative spoon carving.Adler, Shirley4Fall199858-64SpoonsBook ExcerptsPattern Profile
Pattern Profile: Five Miniature SantasCarving mini Santas from hillbilly country to medieval Europe, five miniature Santa patterns from one talented Pennsylvania carver.Shoemaker, Art4Fall199865-69HolidaysSantasPattern Profile
Charles Jobes: Decoy MakerLearn the secrets to making great-looking decoys.Schroeder, Roger4Fall199870-77DecoysProjects, Step by StepDucks
Carving A Tagua Nut Name StampCreate your own personal stamp from this popular carving material.Mignone, John4Fall199878-83Step by StepStampsMiscellaneous
Name Tag ContestWhat's in a name? About $100 and a free two-year subscription to Wood Carving Illustrated. Look for our rules to enter.WCI Staff4Fall199887ContestsRulesRegulations
Cane CornerWe Review an interesting new book from across the pond.Jones, AndrewGeorge, Clive5Christmas1998106-107CanesPattern ProfilesAnimalshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Villa Maria Wood CarversA treasure of instruction in the Midwest.Schroeder, Roger & Sheila5Christmas199814-15PeopleTipsArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Carver's Open HouseYou're invited to our 2nd Open House! Free admission, contests, tools and carving demonstrations. Don't miss it!WCI Staff5Christmas199817Fox Chapel's Open HouseCelebrationhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Getting Your Feet Wet: Some Fish Carving BasicsDive into carving your own fish, plus tips on packing carvings for shipping.McKenzie, Ray5Christmas199819-22Step by StepFishBasicshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Toothpick CarverBob Shamey brings new meaning to the word ''miniature'' with his carvings.Chow, Naomi5Christmas199824-25MiscellaneousToothpickTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Poor Man's Contest WinnerFor $20 and an hour of your time, you can make our ''1757'' carving vise.WCI Staff5Christmas199826-28ToolsContestsRuleshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Tool Grinding For Wood CarversTool Grinding for Wood Carvers by Ian Kirby - What to look for when selecting a grinder and grinding wheels. Techniques for different tool profiles.Kirby, Ian5Christmas199830-33SharpeningToolsTipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Air ToolsAn introduction Wood Carvers by Greg KrocktaKrockta, Greg5Christmas199838-40ToolsTipsArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Santa from Around the World & Across the AgesOld St. Nick, Father Christmas, Pere Noel, Julesvan - Santa Claus has a rich and varied history around the world. Art Shoemaker shares his research into the history and design of different version, plus a pattern for the Norwegian Julesvan.Shoemaker, Art5Christmas199843-47Pattern ProfilesSantaHolidayshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Carving the Acanthus Leaf: The Secret to Knowing Your Tool ProfilesTry your hand at this classic design.Szentgyogyi, Ernest5Christmas199849-52Projects, Step by StepAcanthusTraditionalhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Carve Your Own GnomeA step-by-step class to carve your own little guy.Kraus, Lyle5Christmas199854-62GnomesPattern ProfilesProjects, Step by Stephttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Carving a Woman's FaceThe beauty comes with versatile cuts.Oar, Ross5Christmas199863-69Step by StepPattern ProfilesFacePeoplehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Carving RoscoeDetailed step-steps on how to carve & paint this country caricature.Shipley, Mike5Christmas199870-79Step by StepPattern ProfilesPainting TechniquesCaricaturesPeoplehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Getting a Hold on Woodcarving, Making a Drawer PullThis small project will help develop new carving skills.Schembri, Joseph5Christmas199880-85Step by StepPattern ProfilesDrawer Pullshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Carving the American BisonThis bison project was presented as a 1998 seminar at Stonegate Woodcarving School.Russell, Frank5Christmas199886-90Step by StepPattern ProfilesAnimalsBisonhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Museum of WoodcarvingA sneak preview of the collection.WCI Staff5Christmas199896MuseumsGalleryHistoryhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Making a carver's Skew ChiselRay Larsen is the master smith at the Genuine Forgery in Hanover, MA.Larsen, Ray5Christmas199897-102ToolsTipsArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-5-holiday-1998.html
Selling Your CarvingsA New book offers valuable advice.WCI Staff6Winter199911Book ExcerptsTipsBusiness Advicehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
WCI's Open House - You're Invited!Check out the information for and directions to our 2nd Open House.WCI Staff6Winter199911/13/2014Fox Chapel's Open HouseCelebrationhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Carving An Iris - Dave SabolLearn how to carve this ''rainbow'' flower.Sabol, David6Winter199914-21Projects, Step by StepPattern ProfilesFlowersPainting Techniqueshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Earth Mother Of The Mohicans The Medicine WomanTake a look at Armand LaMontagne's life-size sculpture of Gladys Tanatquidgeons.Schroeder, Roger6Winter199924-29IndiansPeopleSculptureshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Fox Chapel's Carving MuseumManaging Editor, Roger Schroeder, shares his carving collection.Schroeder, Roger6Winter199930-35MuseumsGalleryHistoryhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Carving Fitz the LeprechanThis whimsical shelf sitter is sure to bring you the luck of the Irish.Hull, Joel6Winter199940-47Projects, Step by StepPattern ProfilesHolidaysLeprechanhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Readers' SurveyAnswer some questions and you may win a prizeWCI Staff6Winter199949SurveyContestWinnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Soft Feather TexturingFrank Russell demontrates the art of carving realistic feathers.Russell, Frank6Winter199951-54TexturesBirdsFeathershttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Professional Doll Making: The Art of Michael LangtonCreating life-like dolls is Michael Langton's specialty.Ryan, Kathleen6Winter199957-60DollsPeopleArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Layering and Blending Feathers: Techniques for Painting WildfowlCarol Happley makes painting feathers on wildfowl.Happley, Carol6Winter199962-66Painting TechniquesBirdsFeathersProjects, Step by Stephttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Painting a Rainbow troutLearn airbrushing techniques from experts Ed Walickiand and Tom WolfWalicki, TomWolf, Tom6Winter199969-73Painting TechniquesStep by StepFishhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Three Dimensional ReliefHarley Schmitgen carves a ''svelte'' portrait of Civil War General, Robert E. Lee.Schmitgen, Roger6Winter199974-79Relief CarvingStep by StepPeoplehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Chip Carve a RosetteRich Notto shares four unique patterns.Notto, Rich6Winter199982-83Chip CarvingBeginnerPatternshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Carving Wolves, Foxes & CoyotesSneak a peak at Desiree Hajny's new book ''Carving Wolves, Foxes and Coyotes'', which contains advice on anatomy and expressions.Hajny, Desiree6Winter199984-86Book ExcerptsAnimalsRealistichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Make an Adjustable Carver's ViseBuild a vise from an old trailer hitch - a clever tip from one of our penny-wise readers.Rayburn, Rich6Winter199987TipsShopmadeVisehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
Carving Whimsical BirdsCute-as-a-button chirpers are carved on wooden eggs.Dunkle, Laura Putnam6Winter199988Book ExcerptsBirdsWhimsicalhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-6-winter-1999.html
The Woodcarvers Retreat in New England:Carving in the WoodlandsCarvers turn out for foliage and instruction in New England.Schroeder, Roger7Spring/Summer199912RetreatsTipsNews
Mid-America woodcarvers Hold 24th Annual Fall ShowA Nebraska club holds its 24th Annual Show.WCI Staff7Spring/Summer199914ShowsNewsHighlights
Carving a Weathered EyeJeff Phares breathes life into his carved faces.Phares, Jeff7Spring/Summer199917-21Pattern ProfilesProjects, Step by StepBook ExcerptsPeopleEyes
Western ArtA thorough researcher, William Churchill captures the spirit of the West.Schroeder, Roger7Spring/Summer199926-31PeopleWesternArtist Profile
Carving and Painting a Green-Winged Teal Feather - Part 1Lori Corbett orchestrates feather carving.Corbett, Lori7Spring/Summer199933-35BirdsFeathersArtist Profile
Cigar Store IndiansCommercial art once included Native Americans as tobacco shop signs.Schroeder, Roger7Spring/Summer199936-39IndiansNative AmericansHistory
Woodcarving and the Boy ScoutsAyleen Stellhorn covers the history of the Wood Carving Merit Badge.Stellhorn, Ayleen7Spring/Summer199942-45Pattern ProfilesMiscellaneousBoy Scouts
Shaping & Texturing Hard FeathersFrank Russell demonstrates how to texture working feathers.Russell, Frank7Spring/Summer199948-49TexturesBirdsFeathers
The Early Work of Armand LaMontagneA premier wood sculptor critiques his early work that paid homage to Native Americans.Schroeder, Roger7Spring/Summer199953-59PeopleIndiansSculptures
Carving a Bison Head: The Realism Comes with the textureDale Martin takes on a variety of texturesMartin, Dale7Spring/Summer199960-63Projects, Step by StepAnimalsBisonTextures
Caricature Carver Andy Anderson: A Broad-Shouldered InspirationHarley Refsal writes about caricature carver, Andy Anderson.Refsal, Harley7Spring/Summer199964-69CaricaturesPeopleArtist Profile
Carving a Native American Bust: Facing Character and HistoryBob Lawrence faces a carving challenge.Lawrence, Bob7Spring/Summer199972-79IndiansPeopleStep by StepPattern Profiles
Turning Swords into Chisels: The Story Behind Japenese Carving ToolsJohn Mignone shares why they are worth a serious look.Mignone, John7Spring/Summer199981-84ToolsJapeneseTips
Carving a Cowboy Head: A taste of the Old WestPeter LeClair makes a corker.Leclair, PeteKochan, Jack7Spring/Summer199985-91CaricaturesStep by StepPattern ProfilePeople
Carving Among friends - The CCA'a Friendship CaneSegments you'll appreciate from the Caircature of America's friendship Cane, plus tips on how you can start your own friendship cane.Hulst, Naomi8Fall1999109-113CanesWalking SticksCaricatureshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Artistry in Wood Show ReportHulst, Naomi8Fall199911Artistry in WoodCarving ShowHighlightshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
The Winchester Rifle: Tamer of the Wild WestA symbol of the Old West in an ideal project for novice carvers.Stetson, Dave8Fall1999114-119Step by StepPattern ProfilesMiscellaneoushttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Carver's Paint Box: An Introduction to Acrylic Paints and PrimersDo you painting techniques need a boost? Lori Corbett introduces you to acrylics - the carver's preferred paints.Corbett, Lori8Fall199914-15PaintTipsTechniquehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Basswood: A Carver-Friendly WoodIt's easy to carve.Mignone, John8Fall199916-19Wood ReviewsBasswoodTipshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Carving Simple AnimalsSee last year's winner and how to enter this year's contest.Hansen, Herb8Fall199920-24AnimalsContestsHighlightshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Foredom Blue StonesNew Product ReviewRussell, Frank8Fall199928-29Tool ReviewsPower CarvingTipshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Carving Through the Ages - Part 1 The YoungsterLearn to carve a young man's bust with Dave Sabol.Sabol, David8Fall199930-38Projects, Step by StepPattern ProfilesPeopleCaricatureshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
News of WCI's Open HouseOur 2nd Annual Open House was a huge successHulst, Naomi8Fall19994Fox Chapel's Open HouseWelcomeCelebrationhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Making the Best of Acyrlic PaintsDesiree Hajny demonstrates acrylic effects.Hajny, Desiree8Fall199941-43Painting TechniquesTipsTechniquehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Pineapple - A Sign of HospitalityGreg Korckta carves and gold leaves a classic symbol.Krockta, Greg8Fall199945-52SignsMiscellaneousPineappleGildinghttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
The Alchemist at WorkMaster carver Armand LaMontage reveals common and uncommon painting methods.Schroeder, Roger8Fall199953-57PeopleRealistic FiguresPainting Techniqueshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Alaskan Wildlife - A Carver's Reference GalleryDon't be without this wilderness wildlife reference.Hulst, Naomi8Fall199960-63AnimalsWildlifeGalleryBook Excerptshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Relief Carving: Getting to Know Your ToolsIvan Whillock teaches the basics.Whillock, Ivan8Fall199964-68Relief CarvingStep by StepArtist Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Flexcut Contest WinnersThe first internet carving contest lets participants vote for their favorite carving.Hulst, Naomi8Fall19996/7/2014ContestsGalleryHighlightshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Feather Painting - Part 2 A Green Winged Teal FeatherPaint a realistic feather with Lori CorbettCorbett, Lori8Fall199970-74Painting TechniquesBirdsFeathershttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Airbrushes for WoodcarversPower Carving Eiditor Frank Russell reviews the latest in airbrushes.Russell, Frank8Fall199976-83Painting TechniquesAirbrushTool Reviewhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Pattern Profile: The Hero of St. BernardThe patter for this St. Bernard dog comes from Managing Editor - Roger Schroeder's carving collection.Schroeder, RogerKochan, Jack8Fall199985-87AnimalsDogsPattern Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
The Alchemy of Doll Making - Part 2Michael Langton Makes wooden dolls look real.Ryan, Kathleen8Fall199988-92Projects, Step by StepDollsPeoplehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Cover Feature: Painting a Whitetail BuckThe trophy deer is an eye-catcher.Hulst, Naomi8Fall199995-97Painting TechniquesBook ExcerptsAnimalsDeerhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Ward World 1999 ChampionshipCarving advice from an expert on stylized sculpture.Hulst, Naomi8Fall199999-105ChampionshipsSculptingTipshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-8-fall-1999.html
Tips: Relief Carver's WorkbenchDePauw, VernonKochan, Jack9Holiday199914TipsRelief CarvingTechnique
Introduction to Standard Chip CarvingMcKenzie demonstrates his art a chip at a time.Mckenzie, Barry9Holiday199916-18Chip CarvingBeginnerArtist Profile
Norwegian CarvingLearn the art of kolrosing from Ervey ShelleyErvey, Shelley9Holiday199923-26Kolrosing (Norwegian Carving)SpoonsPattern ProfileProjects, Step by Step
Goose Pin - Come Fly With MeCarve a goose pin in 14 steps with Roger MorencyMorency, Roger9Holiday199928-30Projects, Step by StepBirdsGoosePins
Holiday Patterns for Chip CarversRoger Nancoz offers the holiday spirit with his ornamentsNancoz, Roger9Holiday199932-37Pattern ProfilesHolidaysOrnaments
Up on the House Top: A Chimney SantaMike Shipley put Santa in a ChimneyShipley, Mike9Holiday199939-45Projects, Step by StepPattern ProfilesHolidaysSantas
Carving a Christmas Elf with David SabolBrighten up your home with David Sabol's elf and Christmas tree.Sabol, David9Holiday199950-59Projects, Step by StepPattern ProfilesHolidaysElf
A Look at Cane MakingCollector William Paisley draws inspiration from the masters.Paisley, William9Holiday199960-64CanesWalking SticksGallery
Pattern Profile: DynamiteA lively pattern from Gary Batte's new book, ''Carving Crazy Critters''.Batte, Gary9Holiday199966-68Pattern ProfilesCaricaturesAnimalsHorses
Wood Review: Butternut - Wood of the GodsWCI's wood column offers everything you need to know about this favored carving wood.Schroeder, Roger9Holiday199971-74Wood ReviewsButternutTips
Anatomy of ButternutFred Cogelow reveals why he chooses this species.Cogelow, Fred9Holiday199976-78Wood ReviewsButternutTips
Christmas RedsTina Toney shares painting tips and a Santa pattern.Toney, Tina9Holiday199980Painting TechniquesSantasHolidays
From Ancient Trees to Works of ArtChris White turns ancient trees into sculptures.Stellhorn, Ayleen9Holiday19998/10/2014SculpturesBook ExcerptsTrees
Carving in the Round Pattern Profile: HoboA Tygg carving classic.Schroeder, RogerKochan, Jack9Holiday199986-88Pattern ProfilesCaricaturesPeople
Arizona Sand GuppyDon't be fooled by Dave Stetson's fish - it's a perfect beginner's project.Stetson, Dave10Spring200013-18Projects, Step by StepCaricaturesFish
More on the Sharper EdgeBob Yorburg returns with tips on sharpening V tools.Yorburg, Bob10Spring200021-23Tool ReviewsSharpeningTips
V ToolJohn Mignone helps readers get a grip on an essential tool and then shows how to carve an eagle with it.Mignone, John10Spring200024-27Projects, Step by StepToolsBirdsEagles
The Story of TrollsNot all trolls are evil; some are just a little mischievous.Refsal, HarleyHulst, Naomi10Spring200030-31Pattern ProfilesPeopleCaricaturesTrolls
American Folk Art CanesCollector George H. Meyer shares the best of his cane collection.Meyer, George H.10Spring200034-40CanesWalking SticksFolk Art
Shallow Chip CarvingBarry McKenzie shows that shallow chips are an excellent choice for ship carvers.Mckenzie, Barry10Spring200042-44Chip CarvingShallowTechnique
Carving and Painting a BlugegillRay McKenzie's fish is sure to be a trophy.McKenzie, Ray10Spring200050-58Projects, Step by StepPattern ProfilesFish
Getting Hookes on Chip CarvingDiane Harto proves that wooden eggs are fun to carve.Harto, Diane10Spring200060-63Chip CarvingEggsMiscellaneous
Painting a CardinalAlfred Ponte makes painting this bird as easy as counting to 11.Ponte, Alfred10Spring200065-67Painting TechniquesBirdsCardinal
Carving Through the Ages - Part 2 The Old TimerDave Sabol brings a child to old age with well-placed wrinkles.Sabol, David10Spring200070-77Pattern ProfilesProjects, Step by StepCaricaturesPeople
Wood Review: Mahogany - A Classic WoodFor the last three centuries, carvers have treated this wood as a classic.Schroeder, Roger10Spring200080-83Wood ReviewsMahogany Info
You're Invited to Wood Carving Illustrated's 3rd Open HouseDemonstrations, exhibits, free seminars and more!WCI Staff10Spring20008/11/2014Fox Chapel's Open HouseCelebration
Pattern Profile: The BearThe Japenese excel at the art of bear carving.Schroeder, RogerKochan, Jack10Spring200085-87Pattern ProfilesAnimalsBears
Singing the praises of the Lark CarouselA Minnesota work art is a popular stop for tourist of all ages.Schroeder, Roger11Summer200011/13/2014Carousel AnimalsAnimalsMidwest
Be Smart-Carve an EggheadPete LeClair loves to carves faces.Leclair, Pete11Summer200018-24CaricaturesFacesEgg
2nd Poor Man's Tool ContestWCI invites readers to submit tool ideas that keep the money in the bank.WCI Staff11Summer200025ContestsToolsTips
Pattern Profile: One Too ManyA tipsy drunk keeps to his feet.Schroeder, RogerKochan, Jack11Summer200026-28Pattern ProfilesPeopleTipsy
An introduction to Old World-Style Chip CarvingBarry McKenzie continues his series on chip carving styles.Mckenzie, Barry11Summer200030-32Chip CarvingOld-WorldTechnique
The Great Circus ParadeCarved circus wagons are the feature of this annual Milwauke, Wisconsin event.Schroeder, Roger11Summer200034-43Circus ArtMuseumsParade
A Love Affair with WoodManaging Editor Roger Schroeder shares his rewarding wiriting career.Schroeder, Roger11Summer20003/5/2014MiscellaneousFeatureWood
Taking a Front Seat with John Bauer, Furniture MakerNew Mexico woodworker carves his creations.Schroeder, Roger11Summer200044-45FurnitureFeatureArtist Profile
Carving An Acanthus SpoonPhillip Odden demonstrates carving the Norsk way.Odden, Phillip11Summer200052-56SpoonsAcanthusProjects, Step by Step
Pattern Profile: Three Happy FellasA Swedish carver creates a trio of men on the town.Refsal, HarleyHulst, Naomi11Summer200058-59CaricaturesPattern ProfilesPeople
A Hot ProjectPeter Ortel carves a fireman's bustOrtel, PeterSchroeder, Roger11Summer200060-68Projects, Step by StepPattern ProfilesPeopleCaricaturesFireman
Wood Review: Black Walnut: An American AristocratWCI's wood column offers everything you need to know about this favorite carving wood.Schroeder, Roger11Summer200070-73Wood ReviewsBlack WalnutInfo
Black Walnut: A Wood Worth CarvingRay Kunz shares his experience with this species.Schroeder, Roger11Summer200074Wood ReviewsBlack WalnutInfo
Angelic Sculptures in WalnutBennett pushes pushes wood to its limits when he creates abstract art.Bennett, Blackburn11Summer200076-80SculpturesAngelArtist Profile
Rocky Mountain Wood Carving SchoolAlberta, Canada is the site for popular carving instructors and studentsSchroeder, Roger11Summer200082-83Carving SchoolsRocky MountainsInfo
Festival Deomnstrates Art in the MakingJamestown, New York Audobon show puts artists to work.Stellhorn, Ayleen11Summer200084-85MiscellaneousFestivalsCarving Shows
Carving for Safety's SakeRead 10 tips to keep you safe and healthy.12Fall200012TipsSafetyToolshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
The PussycatArt Shoemaker's feline is a purr-fect carving for the beginner.Shoemaker, Art12Fall200016-23AnimalsCatsProjects, Step by Stephttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Pattern Profile: Wine StewardHere's a project that puts a cork in your favorite bottle.Kochan, Jack12Fall200025MiscellaneousPattern ProfilesWinehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Color Wheel BasicsMixing is easy as saying red, yellow and blue.Corbett, Lori12Fall200026-30PaintColorsTechniqueshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Fine Art of Carousel Restoration and PaintingPam Hessey shares her magic for bringing wooden figures back to life.Hessey, Pam12Fall200032-37Carousel AnimalsRestorationTechniquehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Introduction to Free-Form Chip CarvingBarry McKenzie describes what he calls calligraphy with a knife.Mckenzie, Barry12Fall200038-40Chip CarvingMiscellaneousFree-Formhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Landscapes in ReliefLora Irish offers tips from her book.Irish, Lora S12Fall200043-47Relief CarvingMiscellaneousLandscapeshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Sign Up for Carving a Little GuyCreate custom announcements with Larry Spinak's diminutive figure.Spinak, Larry12Fall200052-59CaricaturesProjectsProjectshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Pattern Profile: Troll GirlDon't discount a girl with pointed ears and a tail.Hull, Joel12Fall200060-61CaricaturesPattern ProfilesPeopleTrollshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Clay and CarvingBefore carving a figure, make a realistic model with the help of simple household items.Rhodes, Karen12Fall200064-69AnimalsBearsPeopleProjects, Step by Stephttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
British InvasionIan Norbury, one of Europe's premier carvers, comes to the U.S. to offer instruction.Stellhorn, Ayleen12Fall20006/9/2014Realistic FiguresBritishArtist Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Flexcut Tools Put to the TestTool reviewer John Mignone finds praise a unique design.Mignone, John12Fall200072-75Tool ReviewsProduct ReviewInfohttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Tips: Dust CollectorControl dust with an inexpensive machine you can make on your own.Smith, Jim12Fall200076-77Dust CollectorTipsShopmadehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Wood Review: PineFrom match sticks to sculpture, pine has played a prominent role in American industry and art.Schroeder, Roger12Fall200078-81Wood ReviewsPineProjectshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Quarter Century ClubA long Island, New York carving club celebrates a silver anniversary.Schroeder, Roger12Fall200084-85MiscellaneousCarving ClubNYChttp://foxchapelpublishing.com/wood-carving-illustrated-issue-12-fall-2000.html
Carver of the Year AwardWatch Harold Enlow Grandpa of the Caricature Carvers receive the 1st annual award.Enlow, Harold13Holiday200013AwardsWinnerCarving Clubhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
The Screech OwlArt Shoemaker offers an ideal beginner's projectShoemaker, Art13Holiday200017-23AnimalsOwlsBirdsCaricaturesProjects, Step by Stephttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Carving a Christmas Ornament or Wall SwitchLight up the holidays with a colorful relief carving.Toney, Tina13Holiday200024-31Relief CarvingSantasOrnamentshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Pipes of WhimsyJames Margroum turns a pipe dream into an art form.Schroeder, RogerMargroum, James13Holiday200033-38ProjectsWhimsiesWhittlehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Brush Basics - Part ILori Corbett takes the guesswork out of a hirsute subject.Corbett, Lori13Holiday200040-43Paint BrushesBrush CareTipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Confessions of a Woodcarving CollectorManaging Editor Roger Schroeder writes about a 20-year search for a special woodcarving.Schroeder, Roger13Holiday200044-46PeopleGalleryArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Chessmen with MettleRobin Hood and other characters of Sherwood Forest come alive.Moon, Dr. John13Holiday200054-59ChessRobin HoodSherwood Foresthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Olde World SantaJoel Hull looks back in time to carve St. NickHull, Joel13Holiday200065-73Projects, Step by StepSantasHolidayshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Introduction to Chip Carved DecorationsBarry McKenzie desk the halls with novel chip carvings.Mckenzie, Barry13Holiday200074-75Chip CarvingMiscellaneousHolidayshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Tormek Put to the TestGrinding and honing with Tormek has never been easier or more preciseSchroeder, Roger13Holiday200076-79Tool ReviewsProduct ReviewTipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Open House 2000A review of the annual event gives it highest marks. Prepare for Open House 2001Stellhorn, Ayleen13Holiday20008/11/2014Fox Chapel's Open HouseGalleryCelebrationhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Wood Review: AppleTake a shine to a wood that offers sterling qualities for the carver.Schroeder, Roger13Holiday200082-84Wood ReviewsAppleInfohttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Santa Head Finishing TechniquesCarole Jean Boyd demonstrated that god finishing is in the flow.Boyd, Carol Jean13Holiday200085-89Projects, Step by StepSantasHolidayshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-13-holiday-2000.html
Windsor Wood Carving MuseumEye-catching exhibits make this a must-see museum.Schroeder, Roger14Spring200114-16MuseumsHistoryExhibithttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Tecumseh Comes to WindsoeNeil Z. Cox sculpts a Canadian legend.Schroeder, RogerCox, Neil Z14Spring200118-19IndiansPeopleArtist Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Carving and Painting a MagpieCam Merkle illustrates how to create this strikingly iridescent bird.Merkle, Cam14Spring200120-26Painting TechniquesProjects, Step by StepBirdshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Figurative FurnitureJamie Russell Brings together carved figures and impeccable joinery.Russell, Jamie14Spring200127-32FurnitureFiguresTechniquehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Carving HorsesYou can bet that Llew Bertsch's horses have just the right proportions.Bertsch, llew14Spring200133-36AnimalsHorsesRealistichttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
PyrographyCarole Peters warms us up to a hot topic among woodcarvers.Schroeder, RogerPeters, Carole14Spring200138-43PyrographyWoodburningArtist Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Canadian Carves CanesDave Kemp makes canes fit for a knight.Schroeder, RogerKemp, David14Spring200144-46CanesWalking SticksKnighthttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
In the Spirit of Bark CarvingTony Wispinski teaches how to bark up the right tree.Schroeder, Roger14Spring200152-58Bark CarvingMiscellaneousTechniquehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Swiss-Made Tools Put to the testThis brand stays on the cutting edge of great tools.Mignone, John14Spring200160-63Tool ReviewsShopTpp;shttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Wood Review: BirchIt's a wood suited to both poets and woodcarvers.Schroeder, Roger14Spring200164-65Wood ReviewsBirchInfohttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Carving and Painting a Killer WhaleTake the plunge with Dennis Dreschler and create a striking sculpture.Drechsler, Dennis14Spring200166-75AnimalsWhalesProjects, Step by Stephttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Brant FestivalVancouver Island, British Columbia offers a top carving show.WCI Staff14Spring200176-77ChampionshipsFestivalHighlightshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Moor Chip CarvingFather and son team is kicking up the chips across North AmericaMoor, Dennis14Spring20018/11/2014Chip CarvingFamily AffairArtist Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-14-spring-2001.html
Contented PigMake a place on your shelf for Art Shoemaker's adorable animal.Shoemaker, Art15Summer200112/19/2014AnimalsPigsHappy
Review: Chainsaw CarvingHal MacIntosh's new book presents the art and the craft of power carving.MacIntosh, Hal15Summer200120-21Chainsaw CarvingTechiqueBook Review
Chimp CarverJack Kochan creates WCI's first simian readerKochan, Jack15Summer200122-23AnimalsChimpanzeeRealistic
Carving and Painting a Magpie - Part 2Cam Merkle's paintinng technies bring this prairie bird to life.Merkle, Cam15Summer200124-30BirdsPaintTechnique
Making FacesLearn the basics for carving a caricature face.Hull, Joel15Summer200132-38CaricaturesPeopleFace
Introduction to Individial Styles of Chip CarvingChip carvers push the limits with their creative work.Mckenzie, Barry15Summer200139-41Chip CarvingTechniquesTips
Making a KnifeJohn Mignone designs a cutting tool fit for a professional carver.Mignone, John15Summer200142-47Projects, Step by StepToolsShopmade
Product Review: BloxygenIt's a gaseous solution to dry-out.WCI Staff15Summer200147Product ReviewsBloxygenTips
Pinewood Forge Knives Put to the TestFine tools are available for a variety of carving operationsMignone, John15Summer200152-55Tool ReviewsKnivesForged
Wood Review: YewA beautiful wood inspires masterful carvingsMignone, John15Summer200158Wood ReviewsYewInfo
Ships' FigureheadsTake a look at the best of maritime commercial art.Schroeder, Roger15Summer200159-63PeopleShipsMaritimes
Reader SurveyWCI's second survey polls the interests of it's readership.WCI Staff15Summer20016SurveyInfoHighlights
Carving a Canvasback DecoyIt's an easy project with just a few tools and paints.Jobes, Charles15Summer200165-73DecoysStep-by-StepBirds
Brushes - Part 2Lori Corbett offers tips on caring for and purchasing brushes.Corbett, Lori15Summer200174-76Paint BrushesBrush CareTips
Hot Spots for Carvers - Part 1Plan to spend some inspiration time and view a museum's carving collection.WCI Staff15Summer200178-81MuseumsTipsInspiration
Realistic Flowers in WoodCarved flowers come alive with tips from author Wanda MarshMarsh, Wanda16Fall200123FlowersRealisticRelief
Open House ReviewRelive the fun, see what you missed, plan to visit us in 2003.WCI Staff16Fall200116-17Open HousePeopleCelebration
Woodcraft ContestFifty-three Santas from across the country compete for the prize.Schroeder, Roger16Fall200124-28SantasContestsWoodcraft
Black Bear CubArt Shoemaker's project is sure to please beginners and pros alike.Shoemaker, Art16Fall200129-35Projects, Step by StepAnimalsBears
The Carvings of Harold EnlowOzark is a living legend in the world of caricatures.Enlow, HaroldSchroeder, Roger16Fall200136-38CaricaturesPeopleArtist Profile
Chip-Carved TrayBarry McKenzie serves up a winning and colorful project.Mckenzie, Barry16Fall200139-41Chip CarvingMiscellaneousHome Decor
Turbo Carver Put to the TestA Speedy air tool comes at a bargain price.Kochan, Jack16Fall200142-43Power CarvingTool ReviewsShop
Hand Carving a PinCarve this quick and easy pumpkin pin.Spinak, Larry16Fall200144-48Projects, Step by StepAnimalsBearsMiscellaneous
Carving the WoodcarverA caricature carved a caricature in a humorous and challenging composition.Batte, Gary16Fall200149-58Projects, Step by StepCaricaturesFunny
Special Effects with ColorLori Corbett teacher techniques for wildfowl washes.Corbett, Lori16Fall200159-61BirdsPaintTechnique
The Dust CollectorPoor Man's Tool Contest winner is a healthy and inexpensive inventment for the power carver.Foshay, Louis16Fall200163-65Dust CollectorShopmadeProduct Review
Caricature Pins and BolosGary Batte shares two fun and simple projects.Batte, Gary16Fall200167-68MiscellaneousBeginnerProjects
BenchstonesJohn Mignone cuts to the grit and tells why these sharpening tools are indispensible.Mignone, John16Fall200169-72SharpeningToolsTechnique
Portrait of a BuffaloLora S Irish offers tips from her new books, Wildlife Carving in ReliefIrish, Lora S16Fall200173-75AnimalsBuffaloRelief Carving
Hot Spot for Carvers - Part 2More great museums provide inspiration for carvers.WCI Staff16Fall200176-79Carousel AnimalsMuseumsInspiration
News and NotesEvents, projects and personal interest stories in the carving world.WCI Staff16Fall20018NewsEventsFeatures
Wood Review: HollyDeck your halls with projects from this fine, white wood.Schroeder, RogerSchembri, Joseph16Fall200182-83Wood ReviewsHollyHoliday
Product ReviewsMagni-Focuser: A new design for the millenium. Transfer Tool: A hot item for carvers. Wipe-On Gel PolyFinish: A no-brush answer to finishing wood. Hot Tool WB-1 Woodburner: A hot item at a cool price. Black & Decker RTX High Performance Rotary Tool: A oackage of power & precision.WCI Staff17Holiday200115-17Product ReviewsToolsTips
Hand Carving SnowmenMike Shipley's versatile snowmen.Shipley, Mike17Holiday200121-23HolidaysSnowmenDecoration
Wood in MotionThe chainsaw sculptures of J Chester Armstrong.WCI Staff17Holiday200125-29SculpturesHolidayHome Decor
Holiday Card or Napkin HolderA great beginner's project suitable for the season.Hayden, Will17Holiday200130-31HolidaysHome DecorProjects
Stackable SantaA unique approach to make changes easier.Richardson, John17Holiday200132-40Projects, Step by StepSantasHolidays
The Great Book of Dragon PatternsLora Irish's adaptable patterns.Irish, Lora S17Holiday200141-43Book ExcerptsDragonsCeltic
Icicle OrnamentChip Carving ''On the Edge''Mckenzie, Barry17Holiday200144-46Chip CarvingIcicle Ornaments
Mountain LionsA majestic bust of a mated pair.WCI Staff17Holiday200148-51AnimalsMountain LionsPattern Profile
An Expressive SnowmanA pin or ornament that changes faces.Spinak, Larry17Holiday200152-55Projects, Step by StepPattern ProfilesSnowmenHolidays
Carving the Acanthus Candle HolderA project to brighen your evening.Odden, Phillip17Holiday200156-60Projects, Step by StepAcanthusCandle
Carving the Female FaceWally Leuth's practive tips for capturing the features of the fairer sex.Lueth, Wally17Holiday200161-63PeopleFemaleFace
Mutual RespectA project in contrasting woods.Hattabaugh, Burl17Holiday200164-70Projects, Step by StepAnimalsSwansBirds
Victorian St. Nick Beard the Best Gift EverTake a mini-course in painting a colorful holiday project.Kochan, Jack17Holiday200171-75Pattern ProfilesHolidaysSantasVictorian
Wood Review: GinkgoAn ancient species that still keeps its polish.Schroeder, Roger17Holiday200176-77Wood ReviewsGinkgoInfo
Custom-Made Detail KnifeLow-cost and versatile, make this knife work for you.Diel, Lynn17Holiday200178-79ToolsShopmadeKnife
Product ReviewsJerry-Rig: A work positioner offers an ergonomic design. Pfingst Dust Collector: A quiet machine keeps the environment clean.WCI Staff18Spring200215Product ReviewsToolsTips
Berold Tools Put to the TestJohn Mignone gives these specialty tools high marks.Mignone, John18Spring200221ToolsProduct ReviewShop
Tools by BeroldQuality custom-made tools run the gamut of sizes.Schroeder, Roger18Spring200218-21ToolsProduct ReviewShop
Whittling Twigs and BranchesChris Lubkemann's book offers a new twist on bird carvings.Lubkemann, Chris18Spring200222-23WhittlingAnimalsRoosters
Carving & Painting a Rainbow TroutSink your hooks into a project that looks real enough to fry.McKenzie, Ray18Spring200224-31TroutPaintTechnique
A Woodcarver's EducationJesper Osther enrolls in a Swiss carving school for training par excellence.Schroeder, Roger18Spring200232-35SwitzerlandMiscellaneousArtist Profile
Knife CoversProtective projects keep tools sharp and hands safe.Shuck, Kathleen18Spring200236-38ToolsKnifeSafety
A Chip-Carved QuiltBob Rymark blocks out a quilt with colors.Rymark, Bob18Spring200239-42Chip CarvingMiscellaneousQuilt
Making Small Carving TollsLow-cost tools are hot items with the right temperature.Burton, Mike18Spring200243-47ToolsTipsCheap
Kickin' Up the ChipsDavid Sabol carves a fiesty mule suitable as a toy.Sabol, David18Spring200244-55AnimalsMulesCaricatures
Alebrije CarvingsMexican artists carve animals with eye-dazzling colors.Blumer, Harold18Spring200250-55AnimalsCoyotesSouth America
Whittling a Fan-tailed HummingbirdA sharp knife and a wet piece of wood produce a feathered bird.Wiebe, Rick18Spring200256-60BirdsWhittlingHummingbird
The Bust of an EnglishmanJohn Mignone blocks out a classic look.Mignone, John18Spring200261-63MiscellaneousPeopleBust
Kiln-Dried: A Simian StoryJoe Avarista builds his own kiln to dry a sculpture.Schroeder, Roger18Spring200264-67AnimalsMonkeysMiscellaneous
Carving the Human MouthJeff Phares' latest book offers instruction in realistic anatomy.Phares, Jeff18Spring200281-83IndiansRealisticMouth
Wood Review: Black CherryAn attractive tight-grained wood carves well and takes a shine.Schroeder, Roger18Spring200284-85Wood ReviewsBlack CherryInfo
Product ReviewsZinsser SealCoat Universal Sanding Sealer applies easily with professional results. Smith's diamond bench sharpening stone offers a sharper image with new technology.WCI Staff19Summer200213Product ReviewsToolsSander
Woodcarver of the YearMeet WCI's 2002 recipient Pat GodinWCI StaffGodin, Pat19Summer200217-19PeopleWinnerArtist Profile
Carve a RoseEven by another name, it's a great project to tackle with handtools.Szentgyogyi, Ernest19Summer200220-28FlowersPattern ProfilesTechnique
The WoodworkerNo pose is too shallenging with the aid of a clever template.Hull, Joel19Summer200229-33CaricaturesPattern ProfilesPeople
Chip-Carved BirdhouseBarry McKenzie takes some tips from an avian artist and produces a masterpiece.Mckenzie, Barry19Summer200234-36Chip CarvingBirdhousesBirds
Bark Carve a Native AmericanLearn from Phil LaGreco that a tree's outer layer lends itself to a classic face.LaGreco, Phil19Summer200237-45Bark CarvingIndiansPeopleProjects, Step by Step
Tuning Up Your Carving KnifeJoel Hull shares sharpening strategies to keep your tool in tiptop shape.Hull, Joel19Summer200246-49SharpeningToolsKnife
Carving a Folk Art CurlewMike Yannello creates birds stepped in the traditions of old-time decoy making.Yanelli, Mike19Summer200250-55ProjectsBirdsStep-by-Step
Relief Portraits by Armand LaMontagneThe Master compresses baseball heroes with uncanny realism.Schroeder, Roger19Summer200260-65Relief CarvingPeopleBaseball
Totem PolesRoger Schroeder writes about the myths and realities of these family trees.Schroeder, Roger19Summer200266-71IndiansTotemNative American
Club DucksDon't expect quackery when Charles Jobes recycles golf clubs.Schroeder, Roger19Summer200274-75AnimalsDucksBirds
Turtle on a LogRalph Rogo's simple project is a beginner's delight.Rogo, Ralph19Summer200276-82Projects, Step by StepAnimalsTurtles
Wood Review: RosewoodA hard, stable wood can be turned into carvings fit for royalty.Schroeder, Roger19Summer200284-85Wood ReviewsRosewoodInfo
Carving in the European Tradition: The Work of Art ShoemakerA modern-day Geppetto breathes life into his work.Schroeder, RogerShoemaker, Art20Fall200219-21MiscellaneousPeoplePuppet
Carving EyesJeff Phares offers a quick lesson on making an eye study stick.Phares, Jeff20Fall200222-27ProjectsEyesStep by Step
Come Rain, Come ShineLearn how to get your own Noah's ark started for a fun(d) raiser.Schroeder, Roger20Fall200228-32ReligiousAnimalsNoah's Ark
Benchtop Carving ViseUse your surplus lumber and hardware to build a versatile holding fixture at no cost.Foshay, Louis20Fall200233-34ToolsShopmadeVise
Gunstock CarvingBill Janney shares how to turn butt stock into a thing of beauty.Janney, Bill20Fall200235-39Step by StepProjectsTechnique
Carve and Paint a Boston Terrier Leash HolderAn easy and practical project is done with a few tools and at little cost.Passalacqua, Joe & Ellie20Fall200240-49Projects, Step by StepAnimalsDog
Woodland SantaJanet Clemens brings her Christmas carving in touch with God's little creatures.Schroeder, Roger20Fall200250-53SantasWoodlandChristmas
Dragon CarvingMaster carver Ian Norbury turns a slithery serpent into a functional hanger.Norbury, Ian20Fall200255-59Projects, Step by StepAnimalsDragons
A Boxed FlagMake a patriot statement with a clever relief carving.Thomas, Bob20Fall200265-67PatrioticFlagRelief
Carving Found WoodCarvers turn the rough and tumble of sea and forest into works of art.Hood, Vic20Fall200268-70Found WoodSeaForest
Adhesives Part 1Even the stickiest questions get answered in this comprehensive feature.Schroeder, Roger20Fall200271-74ToolsTapeAdhesiveGlue
Biker SantaGo hog wild over Sue Madsen's unique gift giver.Schroeder, Roger20Fall200275-77SantasHolidaysMotorcycle
Veritas Power Sharpening System Put to the TestA dry machine tackles all your grinding needs and then some.Burton, Mike20Fall200278-81ToolsTool ReviewsProduct Review
Wood Review: RedwoodPut your tools to a durable and easy-to-carve wood.Schroeder, Roger20Fall200284-85Wood ReviewsRedwoodInfo
Product ReviewsZyliss portable all-purpose vise is an original Swiss tool that holds it all. Stamp 'n Chip offers pre-made rubber stamp designs perfect for the beginning chip carver.WCI Staff20Fall2002Product ReviewsZylissTools
Product ReviewsFlex-Arm Magnifier doubles the size of your work.WCI Staff21Holiday200217Product ReviewsFlex-ArmTools
Woodcraft Santa ContestA winning carving is just the ticket to appear with PBS craftsman Scott Phillips.WCI Staff21Holiday200218-22ChampionshipsSantasContests
Carve a NutcrackerGet into the holiday spirit with a project cracker up to be a hit…and it's functional!Bigton, ElseOdden, Phillip21Holiday200224-30FoodHolidaysProjects, Step by StepSantasHolidays
The Perky SnowmanEnjoy folk art carving from a Minnesotan who made it to the White House.Schroeder, Roger21Holiday200231-33HolidaysSnowmenFolk Art
Carving Folk Art FiguresSanta Carver of the year Shawn Cipa provides patterns and instructions for angels, moons, Santas and more!Cipa, Shawn21Holiday200236-36Folk ArtAngelsBook Excerpts
Carve a SantaThis gift giver takes a step or two beyond caricature carving.Carville, MicheleStetson, Dave21Holiday200241-47Projects, Step by StepHolidaysSantas
Adhesives Part 2Two-part epoxies offer strength and fill gaps.Schroeder, Roger21Holiday200248-52MiscellaneousToolsAdhesive
Chip-Carved Tree OrnamentsBarry Mckenzie presents beginner techniques for the holiday carver.Mckenzie, Barry21Holiday200253-55Chip CarvingProjects, Step by StepHolidaysOrnaments
Carve a GnomeJoel Hull carves a friendly though sometimes mischievous elf.Hull, Joel21Holiday200256-63Projects, Step by StepGnomesFriendly
Realistic Textures for Bird CarversWell-placed ripples, splits and overlays bring avian carving to new heights.Corbett, Lori21Holiday200265-68TexturesAnimalsBirds
Santa EggheadCheck out Jim Farr's tips on painting a smart looking St Nick.Farr, Jim21Holiday200269-71HolidaysSantasPaint
Sculpting a Portrait in WoodA New Zealand sculptor takes a shine to a U.S. diplomat.Garry, Arthur21Holiday200272-74PortraitsPeopleArtist Profile
The Cypress Knee Carvings of Carole Jean BoydAn Alabaman finds art in a tree's knees.Boyd, Carol Jean21Holiday200275-78PeopleKneesCypress
Wood Review: MapleAmerica's favorite shade tree in an excellent source for quality carving wood.Schroeder, Roger21Holiday200282-86Wood ReviewsMapleInfo
Step-By-Step Relief CarvingA master shares the secrets of light and perspective.Schroeder, Roger21Holiday200285-87Relief CarvingBook ExcerptsTechnique
Product ReviewsThe Oar Sharpener produces razor-sharp results; the Veritas® Carver’s Bench is suitable for a host of carvingsWCI Staff22Spring200310Product ReviewsOar Toolshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Carving Horse Portraits in ReliefA pattern from the Fox Chapel book by Kurt Koch.Koch, Kurt22Spring200385Relief CarvingAnimalsHorseshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Carving a Folk Art TurtleIt's a fishing decoy that can also be a nice piece of folk art!Yanelli, Mike22Spring200322-30Projects, Step by StepFolk ArtAnimalsTurtleshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Sighting the HoleThe not-so-subtle expressions of golfers and their stances score a hole-in-one with caricature carvers.Rogo, Ralph22Spring200331-35CaricaturesGolfHole-in-onehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
The Joys of CarvingMeet Ralph Rogo, whose work reflects his sense of humor.Schroeder, Roger22Spring200335-37PeopleCaricaturesArtist Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Carve and Paint a Loon PinEven a beginner can make an attractive gift.Groncki, Al22Spring200340-44Projects, Step by StepBirdsPinhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Burning Basics for Bird CarversReallistically speaking, woodburning adds a feathery touch.Kochan, Jack22Spring200346-51AnimalsBirdsBurninghttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
A Cast of CharactersThe Caricature Carvers of America holds its first national competition and created a set of study casts.Zercher, Barbara22Spring200352-57CaricaturesCarving ClubArtist Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Bringing Folk Art to the MassesMary Michael Shelley tells stories through her relief carvings.Schroeder, Roger22Spring200358-61Folk ArtHistoryArtist Profilehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Noah’s ArkCarvers and clubs climb aboard a popular project.Schroeder, Roger22Spring200362-65Pattern ProfilesReligiousNoah's Arkhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Casting Part IAn introduction to reproducing your carvings at a reasonable cost.Stetson, Dave22Spring200366-70CastingBudgetHackshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
China CatTom Azevedo carves a natural finish feline.Azevedo, Tom22Spring200371-73AnimalsCatsChinahttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Wood Review: Bald CypressMany carvers seek the knees of this wood for sculptural pieces such as faces.Schroeder, Roger22Spring200374-75Wood ReviewsBald CypressInfohttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Tool Review: Two Cherries Micro Tools to the TestThey keep their edges like other top brand full-size chisels, gouges and V tools.Mignone, John22Spring200382-83ToolsTool ReviewsProduct Reviewhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-22-spring-2003.html
Product ReviewThe Flexcut Crafts Carver set is compact and ideal for entry-level, intermediate and even professional carvers.WCI Staff23Summer200324Product ReviewsFlexcutToolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
The Patterns of Lora S IrishThis Fox Chapel Books author creates an original pattern exclusively for WCI readers in this magazine and in future issues.Irish, Lora S23Summer200340Relief CarvingPatternsTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Tool HolderLynn Diel designs and builds his own enexpensive tool holder and you can too.Deil, Lynn23Summer200319-20Pattern ProfilesToolsShopmadehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Apple Key RackHere's a fun, quick and functional project for a rainy day.Way, Mike23Summer200321-23ApplesKey RackPracticalhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Hillbilly HeadHarold Enlow walks you through his step-by-step ozark's caricatureEnlow, Harold23Summer200325-30CaricaturesPracticalCountryhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Woodcarver of the YearMeet WCI's 2003 recipient, Desiree Hajny.Schroeder, RogerHajny, Desiree23Summer200331-34PeopleWinnerArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Stylized carvingThis area of carving-where the emphasis is on form over detail-is one of the fastest growing. Visit and experience carvers of this style.Solomon, CharlesHamilton, David23Summer200335-38Stylized WoodcarvingBook ExcerptsTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
A Master of Acunthus CarvingBorn in Norway and trained there in this classic style, Hands Sandom desigs and decorates a variety of wooden pieces with this popular motif.Sandom, Hans23Summer200341-4Acanthus CarvingPeopleArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Acanthus Sign BoardA gorgeous sign board can display your carving skills in your home and be a great decorative item.Sandom, Hans23Summer200345-51Acanthus CarvingStep by StepHome Decorhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Carving The NoseFrank Russel shows how to make your carvings a winner by a nose.Russell, Frank23Summer200355-58Power CarvingStep by StepNosehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Casting Part IIDave Stetson demonstrates how to advance to a more difficult carving to mold and cast.Stetson, Dave23Summer200359-64Projects, Step by StepCastingMoldhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
The Native-Style Carvings of Ray MighellsHe draws inspiration from the work of native Americans and First Nations Peoples.Schroeder, Roger23Summer200365-69PeopleNative AmericanArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Black BearWanda Marsh's painting instructions go hand-in-hand with this project.Marsh, Wanda23Summer200370-73Power CarvingAnimalsBearshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Chairpersons of CongressVolunteers such as Larry and Carol Yudis keep the annual International Woodcarvers Congress in session.Weinstein, Mark23Summer200374-77PeopleVolunteersArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Wood Review: JelutongWoodcarvers find this relatively light wood- with its soft but firm texture and medium density-exceptionally easy to carve.Schroeder, Roger23Summer200380-82Wood ReviewsJelutongInfohttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
Duck DecoysWorld Champion Tom Matus shares his tips and techniques creating a working drake mallard decoy.Matus, Tom23Summer200383-85Book ExcerptsAnimalsDuckshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-23-summer-2003.html
One-legged Carving BenchOnly a few tools are needed to make this light-weight, portable device from scrap wood.Carey, Gene24Fall200322ToolsBenchFurniture
Product ReviewThe high-quality Oar Carver Pocketknife is a handy, foldable, carry-anywhere tool, made specifically for carvers.WCI Staff24Fall200332Product ReviewsOar Knife
Product ReviewThe Bucket Box, a combination storage container and tool holder, also can be used as a seat.WCI Staff24Fall200376Product ReviewsBucket BoxTools
Ward World ChampionshipsBe it fish, bird or waterfowl carvings, the quality of these entries reflect the global stature of this popular event.WCI Staff24Fall2003100-101ChampionshipsWard Museum Wildfowl
Scarecrow on PumpkinCarvings with animation bring stories out of your wood.Schroeder, Roger24Fall200322-24Folk ArtHalloweenPumpkin
The 3rd Annual Woodcraft® Santa ContestJustin Gordon’s creative carving and attention to detail for his Santa with a walking stick and woven basket brings him national recognition and a dazzling array of grand prizes.Weinstein, Mark24Fall200323-28ChampionshipsSantasHighlights
Santa Riding Hobby ReindeerThis project appeals to both children and to carvers blessed with moments of child-like creativity.Farr, Jim24Fall200329-31SantasHolidaysReindeer
All About Manikins and Clay ModelsThe first in our new, informative “All About” reference series, this issue learn how to use these tools to work out the problems of a carving in advance.Gonsowski, PhilSchroeder, Roger24Fall200333-36MiscellaneousTechniquesTools
Working with Relief Carving PatternsLearn how to progress from a two-dimensional pattern of a mule deer head to a completed relief carving.Irish, Lora S24Fall200337-39AnimalsRelief CarvingDeer
Relief ColumnMule DeerIrish, Lora S24Fall200340Relief carvingWildlifeDeer
Relief Carve the CaptainGorgeous when completed, this portrait will build your confidence for further relief work.De Angelis, Pat24Fall200341-49Step by StepRelief CarvingMaritime
Sailor with FlagCarved for a reunion with shipmates, this piece by Ross Oar reflects the face of a generation of earnest young men.Oar, Ross24Fall200350-52CaricaturesMaritimeJoyful
Carve and Paint a Sandpiper — Part 1You can create a striking pose using power and hand tools for this step-by-step project.Legg, Ed24Fall200353-60Paint TechniquesStep by StepAnimalsBirds
Trygg Family: Prolific CarversFor carvers and collectors, owning or just seeing the Scandinavian-style works of this talented family can be inspiring.Refsal, Harley24Fall200361-65PeopleArtist ProfileScandinavian
Tool Review: Warren Tools Put to the TestFrom its handle designed to accept interchangeable accessories to the addition of Japanese carving tools, these products merit a serious look from carvers.Mignone, John24Fall200366-68ToolsTool ReviewsWarren
Carving a PorkerHave you seen Ralph Mueller’s little piggies? His “go-by” boards are a great way to visualize each stage of carving.Mueller, Ralph24Fall200369-74Step by StepAnimalsPigs
Three Holiday OrnamentsJoel Hull shows how to complete these relief carvings in less than an hour.Schroeder, RogerHull, Joel24Fall200377-81Step by StepHolidaysOrnaments
Wood for CarversSome of these woods make carving easier; others are more difficult but especially satisfying to use.Self, Charlie24Fall200382-83MiscellaneousWoodCowboy
Little HombreYou can carve this step-by-step caricature from Dave Stetson with only two tools.Stetson, DaveSchroeder, Roger24Fall200385-92Projects, Step by StepCaricaturesMiscellaneous
Architectural CarvingAdd decorative touches to fireplace mantels, desks, tables and chairs with ornamental carving. Get started with a flower pattern.Koch, Kurt24Fall200393-94Book ExcerptsHome DecorFloral
Artistry in Wood 2002A recap of the show Scott Phillips, host of The American Woodshop, calls “One of the top five shows in the country.”WCI Staff24Fall200398-99ShowsHighlightsArtist Profile
Painting Tips for Classic SantasJust in the (St.) Nick of time, practical advice for adding the final touches to your favorite Santa carving.Kaiser, Matt25Holiday200317-19HolidaysPainting TechniquesSantas
Relief ColumnFrench HornIrish, Lora S25Holiday200320Relief carvingChristmasPainting Technqiue
Those Wondrous WizardsHarry Potter has made wizards hot again. Make your own from a Shawn Cipa Pattern and inspiration from your fellow carversCipa, Shawn25Holiday200322-24WizardsFolk ArtHarry Potter
Santas By The DozenOld Saint Nick is master carver Ross Oar's favorite subject. A gallery of photos is sure to inspireSchroeder, Roger25Holiday200326-28HolidaysSantasGallery
Carve and Paint a Miniature Pectoral Sandpiper Part 2Airbrush and sponging techniques illustrated, plus a Complete color mixing guide.Legg, Ed25Holiday200329-32Painting TechniquesStep by StepAnimalsBirds
Carve a Caricature of a Football PlayerStep-by-step photographs take you inside Gary Falin's -workshop.Falin, Gary25Holiday200333-40CaricaturesStep by StepFootballSports
Woodcarving the Nativity in the Folk Art StyleWith peerless patterns, create your own holiday heirloom.Cipa, Shawn25Holiday200341-43Folk ArtHolidaysReligiousBook Excerpts
Expressing My FaithChip carved crosses done with a single knife and divine inspiration.Janssen, Darrell25Holiday200344-46CrossesReligiousChip Carve
Wecheer 330 Flexible Shaft MachinePut to the test, the Wecheer makes the grade, and then some, for novices and professionals alike.Russell, Frank25Holiday200347-48ToolsWecheerProduct Review
Quilts You'll Never Have to WashNo deception here—hand-carved quilts really fetch up to $25,000.Schroeder, Roger25Holiday200350-53MiscellaneousQuiltsTechnique
All About Study CastsThese handy reference tools can reduce your learning curve.Schroeder, Roger25Holiday200354-56CastingMoldsTechnique
Gifts for CarversMake sure Santa sees this list of the season's best ideas.WCI Staff25Holiday200368-71MiscellaneousWish listTools
Carving Santas from Around the WorldIncludes foolproof patterns plus painting instructions for making a Ukranian Hospodar.Joslyn-Carhart, Cyndi25Holiday200375-77SantasBook ExcerptsHolidays
Wood Review: Ohio BuckeyeA surprisingly easy wood to carve.Schroeder, Roger25Holiday200379-80Wood ReviewsOhio BuckeyeInfo
Angel and SantaWinter relief is on the way—simple yet attractive ornaments power-carved in no timeKochan, Jack25Holiday200384-89AngelsHolidaysSantasOrnamentsProjects, Step by Step
Tramp Art SantasEverything old is new again as Jim Maxwell employs a tramp art for a familiar figureMaxwell, Jim25Holiday200390-95Step by StepSantasTramp Art
Gluing Up Relief Carving Panels; It’s in the CamberA few degrees offer a simple solution to a nagging problem.Judt, Bill (W.F.)25Holiday200396-97Relief CarvingMiscellaneousGlue Up
Product ReviewThe Flexcut SlipStrop kit provides molded profiles shaped to accommodate a host of gouges and V tools.WCI Staff26Spring200422Product ReviewsFlexcutToolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Dust Collector: The Bargain VersionMaking one for under $10 is a breeze, and you’ll be healthier in the bargain.Jumper, Elmer26Spring200449Dust CollectorToolsBudgethttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Product ReviewThe Spring Clip Opticaid can be attached to virtually every style of eyeglasses, making even the smallest cuts as clear as a bell.WCI Staff26Spring200476Product ReviewsSpring ClipToolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Ray McKenzie’s Fish GalleryIf the fish aren’t biting, then sit back and cast your eyes on a master carver’s prize winners.Roger Schroeder26Spring200414-15FishGalleryArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
A Sprightly RabbitFollow Larry “Spi” Spinak’s step-by-step photos and take theSpinak, Larry26Spring200417-19AnimalsRabbitsPinsProjects, Step by Stephttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Relief ColumnLighthouseIrish, Lora S26Spring200420Relief CarvingLighthouseSeasidehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Caricature Painting From a ProGary Falin scores a touchdown when painting Pass the Bacon.Gary Falin26Spring200423-26Step by StepCaricaturesPainting Techniqueshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Classic RosesPower carver Bill Janney enhances a family heirloom jewelry boxJanney, Bill26Spring200428-32FlowersKeepsakeStep by Stephttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
On the Wild SideCosponsored by WCI, this first-time wildlife carving competitionSchroeder, Roger26Spring200433-38ChampionshipsWildlifeHighlightshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Little Black DuckBob Buyer’s use of handtools brings intimacy to a full-bodied pieceBuyer, Robert26Spring200439-44BirdsPower CarvedTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
All About SandpaperMaster the nitty-gritty of a useful, though much maligned, carving accessory.Way, Mike26Spring200445-48SandpaperToolsTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Carve a SignIt takes only a few handtools to brighten up your property.Fairchok, Andy26Spring200451-55Step by StepSignsHome Decorhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Design Your Own Caricature or PortraitWCI Editor-at-Large Roger Schroeder couldn’t help but smile whenGonsowski, Phil26Spring200457-61PeopleCaricaturesTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Noah’s ArkW.F. (Bill) Judt’s fascinating relief carving should inspire you toJudt, Bill (W.F.)26Spring200462-67Step by StepReligiousReliefhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Woodcarving the Country Bear and His FriendsShare a pattern from a new Fox Chapel Publishing bookShipley, Mike26Spring200469-72CaricaturesAnimalsBearshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Dogwood Floral EggCarole Jean Boyd’s step-by-step practice egg is an ideal first projectBoyd, Carol Jean26Spring200477-80FlowersEggStep-by-Stephttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Lovebirds SpoonsEnjoy a pattern and learn the history of lovespoons from Sharon Littley and Clive Griffin’s latest book from Fox Chapel Publishing.Littely, SharonGriffin, Clive26Spring200481-84SpoonsLoveTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Wood Review: SassafrasA little-known wood turns out to be a bonus for relief and even ornamental carvers.Schroeder, Roger26Spring200485-87Wood ReviewsSassafrasInfohttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
“Poor Man’s” 538 Model Easy-Hold Carver’s ClampInvest a few dollars and several hours in making a sturdy clampDiel, Lynn26Spring200488-90ToolsShopmadeClamphttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
MoseTake it easy, partner! Just rustle up a handful of tools and craftBishop, Phil26Spring200491-93CaricaturesToolsCowboyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-26-spring-2004.html
Product ReviewThe new Carving Vise improves on the centuries’ old carver’s arm.WCI Staff27Summer200411Product ReviewsViseTools
Guardian Angel FairyEnjoy a pattern and learn about different kinds of fairies from Lora S. Irish’s latest book from Fox Chapel Publishing.Irish, Lora S27Summer200426Book ExcerptsFairiesRelief
Little ChipperOpen or closed, the D2 blade steel is a sterling feature of this comfortable-to-work-with and easy-to-carry chip carving knife.WCI Staff27Summer200456Product ReviewsD2 bladeTools
Relief Carver’s Depth FinderJim Dupont’s homemade tool enables him to obtain accurate measurements for carving in relief.DuPont, Jim27Summer200471Relief CarvingShopmadeTools
Relief ColumnGrapesIrish, Lora S27Summer200414Relief CarvingGrapesTechnique
Bald Eagle PortraitWanda Marsh’s creative textures and thorough painting instructions are sure to take your artistic skills to new heights.Marsh, Wanda27Summer200417-19AnimalsEaglesPortrait
The Cat’s Meow: Carving a Refrigerator MagnetDavid Sabol’s step-by-step mischievous feline will have friends and customers purring for one of their own.Sabol, David27Summer200420-23AnimalsCatsMagnetsProjects, Step by Step
International Woodcarvers Congress 2003Last year’s Affiliated Wood Carvers’ celebration of carving, classes and competition seemed like only yesterday. This year’s event is just around the corner.WCI Staff27Summer200424-25ChampionshipsCarving CongressHighlights
Friendship CaneTwelve carvers and a publisher gave WCI Editor-at-Large Roger Schroeder the best gift a friend could ever receive.Shroeder, Roger27Summer200427-29CanesWalking SticksFriends
Carving Caricature GolfersBill Howrilla’s latest book from Fox Chapel Publishing captures the game in all its many ups and downs.Howrilla, Bill27Summer200430-32CaricaturesGolfBook Excerpts
Carve a Scandinavian-Style TrollMaster carver Harley Refsal sets the pace for beginning carvers with his flat-plane project.Refsal, Harley27Summer200433-39Step by StepTrollsScandinavian
All About MalletsRoger Schroeder puts eight mallets through their paces. There’s definitely one that’s right for you.Shroeder, Roger27Summer200442-46ToolsMalletsProduct Review
Wood Review: BoxelderThe wood’s coral-red streaks and easy-to-sand-and-finish texture make it attractive to carvers.Shroeder, Roger27Summer200447-48Wood ReviewsBoxelderInfo
National Caricature Carving Competition and ExhibitSo many entries put the judges on their toes at the second annual national competition sponsored by the Caricature Carvers of America.Travis, Bob27Summer200449-50CaricaturesChampionshipsHighlights
The Sculptures of Michelle HolzapfelA burl-loving wood sculptor melds carving, turning and textures to create unique, museum-quality vessels.Schroeder, Roger27Summer200451-55PeopleSculptingArtist Profile
Woodcarver of the YearMeet WCI’s 2004 recipient, author and PBS impresario Rick Bütz.Schroeder, Roger27Summer200457-59ChampionshipsPeopleArtist Profile
Setting Up ShopA visit to two carvers’ shops reveals how organization goes hand-in-hand with making the best use of workspace.Schroeder, Roger27Summer200460-64MiscellaneousToolsShop
Father Christmas Woodcraft® Santa Carving Contest finalist Norb HartmannHartmann, Norb27Summer200465-67HolidaysSantasArtist Profile
Light and Fan Pulls a HitSteve Brown steps up to the plate to show that any character or subject can be carved into a decorative and useful pull.Brown, Steve27Summer200468-70CaricaturesHome DecorPractical
Neckerchief SlidesBeginning carvers of all ages will learn four basic cuts by the time they complete these two projects from Boy Scout instructor Robert Reitmeyer.Reitmeyer, Bob27Summer200474-78MiscellaneousNeckerchiefCowboy
Golf Ball CarvingNathan Stump, who brings ducklings and other characters out of their “shell,” finds most golf balls a pleasure to carve.Stump, Nathan27Summer200481-84Golf ballsStep by stepTechnique
Illustrated Guide to Carving Tree BarkLearn, with plenty of photos, the key points to bark carving in a new Fox Chapel Publishing book by Rick Jensen.Jensen, RickWilliams, Jack27Summer200487-90Book ExcerptsBarkTechnique
Decorative Decoy Carver’s Ultimate Painting and Pattern PortfolioMaking changes to existing patterns is the first step toward developing original drawings like those in Bruce Burk’s latest book from Fox Chapel Publishing.Burk, Bruce27Summer200492-93PaintBook ExcerptsDecoys
Arbortech Power ChiselPut to the test, this reciprocating power tool with a snap-lock system runs the gamut from wood hogger to fine detailer.Burton, Mike27Summer200495-97ToolsTool ReviewsPower Carve
Relief ColumnRose-of-SharonIrish, Lora S28Fall200414Relief CarvingFlowersPattern http://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Folk Art FoxHere’s a quick and easy project with lots of appeal.Jumper, Tim28Fall200415-17AnimalsFoxesBeginnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Ozark GrinCarving legend Harold Enlow shows you why the mouth, more than any part of the face, enhances the look of a figure.Enlow, Harold28Fall200418-20CaricaturesMouthTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Carving a Realistic DachshundMastering these basic techniques will enable you to bring any breed of dog out of the wood.Kochan, Jack28Fall200423-27AnimalsDogsRealistichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
From the Mind of JamesThe imaginative and award-winning works of James Fecteau will fuel your passion for carving.Hart, Cathy28Fall200428-29PeopleArtist ProfileCaricatureshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Paint a Scandinavian-Style TrollMaster carver Harley Refsal shares his techniques for painting the character you carved from the last issue.Refsal, Harley28Fall200430-33TrollsScandinavianPainthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Extreme Pumpkin CarvingThis October, showcase your carving skills with something special for Halloween.Hood, VicWilliams, Jack28Fall200439-41Book ExcerptsHalloweenPumpkinhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Product ReviewSealing and priming is faster and more effective and blending is purer with the new JansenArt Traditions high quality matte acrylic paint.Matus, Tom28Fall200442-43Product ReviewsJansenArtFinisheshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Celebrating Small VictoriesHere’s a challenge—try carving in a 2'' x 2'' cube. You won’t believe these carvers’ work from the Dayton, Ohio, Artistry in Wood competitions.WCI Staff28Fall200444-45ChampionshipsCubeCompeitionshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Sassafras TurtleLeo Datzman, a winner in the WCI-Woodcraft® Supply 2003 Wildlife Carving Contest, recalls what he did for his tortoise to finish first in the Amateur—Other Wildlife division.Datzman, LeoKochan, Jack28Fall200447-51AnimalsTurtlesWildlifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Bulldog Bulletin BoardBow-wow wow! Kathy Wise shows how to relief carve this popular dog to watch over your messages and reminders.Wise, Kathy28Fall200453-58AnimalsDogsHome Decorhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
An Introduction to Carving in Miniature—NetsukeWelcome to Susan Wraight’s small, small world of netsuke, part of Japanese traditional dress now highly sought after collector pieces worth $1,000s.Wraight, Susan28Fall200459-64AnimalsMiniatureNetsukehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Lost in Thought Santa—Pattern ProfileHis unique look works wonders in annual carving contest.Shinlever, Wayne28Fall200465-68HolidaysSantaContestshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Wood Review: TulipwoodNot easy to carve but its rich colors, fine texture and straight grain make it appealing.Shroeder, Roger28Fall200470-71ReviewTulipwoodInfohttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
The Dream WeaverThere’s much to learn from professional woodcarver Ian Norbury, whose carvings are in collections all over the world.Norbury, Ian28Fall200474-77PeopleSculptingArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Ultimate Power SharpenerPut to the test, this sharpening machine has a lot going for it, including easy handling of heavy-duty carving tools while running fast enough to make a sharp, polished cutting edge relatively quick.Schroeder, Roger28Fall200479-81Product ReviewsSharpeningPower Carvehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-28-fall.html
Beginner Basics: Brushes and TechniquesPaint your next carving with confidenceStadelman, Kelley S.281Painting & Finishing20045BeginnerPaintingBrushestechniques
8 Reasons to Use Acrylic PaintsA fast and user-friendly medium is the #1 choice among woodcarversSchroeder, Roger281Painting & Finishing200410Acrylic PaintUser-friendlyColor Retentionbeginner
Paint Me By the Numbers and Other Colorful TipsDrop by drop, painting has never been easierFarr, Jim281Painting & Finishing200414ProjectGolferPaintingcraft paint
Airbrush BasicsA supplemental tool enhances birds and other carving projectsKochan, Jack281Painting & Finishing200418AirbrushBeginnersBasicstipsproject
Aniline DyesDissolve these powders for exceptional color and grain enhancementPassalacqua, Joe281Painting & Finishing200424DyesColorWoodgrain
Finishing with Varnish and WaxExcerpt from Carving the Human FacePhares, Jeff281Painting & Finishing200428finishingvarnishwaxstep-by-step
Rex Branson's Finishing TechniqueIncrease your carving's value with this proven finishBranson, Rex281Painting & Finishing200430rex bransonfinishingtechniquewax
Putting a Finish on Interpretive Wood SculptureIt's clearly easy with oil or lacquerKunz, Ray281Painting & Finishing200432finishinterpretive wood sculptureoil finish
Finishing with Shoe PolishNew use for an old product, excerpted from Relief Carving Patterns, Tips & TechniquesJudt, William F.281Painting & Finishing200435shoe polishfinishmeltonian shoe cream
Folk Art FinishingGive your caving a well-worn look in a weekendCipa, Shawn281Painting & Finishing200436folk artfinishwell-worn lookstain
Rainbow Trout Eye Paint ScheduleSave money and hassles by creating and painting your own eyesSchreibeis, Clark281Painting & Finishing200438fisheyepaintstep-by-step
Paint Any FishGet professional results without an airbrushCastillo, Joe281Painting & Finishing200441fishpaintingprofessional
Basecoating BasicsChampionship tips and advice for adding life to your decoyMatus, Tom281Painting & Finishing200444basecoatbasicsdecoy
Mallard Paint PatternExcerpt from Decorative Decoy Carver's Ultimate Painting & Pattern Portfolio, Series OneBurk, Bruce281Painting & Finishing200448paintingpatterndecoy
A Bird Carver's PrimerKeep your paint schedule in mind as you textureKochan, Jack281Painting & Finishing200450birdcarvingprimer
Hot Wildfowl Painting TipsFive world-class bird carvers tell all!281Painting & Finishing200455wildfowlbirdscarvingpaintingtips
Painting SantaGetting rich reds while allowing the beauty of the grain to shine throughCarville, Michele281Painting & Finishing200464paintingholidayssantastep-by-step
Carving a Traditional Flat SantaHere's an easy-to-carve holiday ornament idea that's as fun to carve as it is to give.Johnson, Skylar29Holiday200414-16SantasHolidaysOrnamentsProjects, Step by Step
Relief ColumnSanta Pattern with hollyIrish, Lora S29Holiday200418SantasHolidaysHolly
Quick Carve SnowmanOnce you master the simple techniques, it is easy to personalize these holiday favorites for everyone on your gift list.Joslyn, Cyndi29Holiday200420-25HolidaysPattern ProfilesProjects, Step by StepSnowmen
Egghead SantaSeveral gift ideas can ''hatch'' from this project suitable for beginner's.Farr, Jim29Holiday200427-30SantasOrnamentsProjects, Step by Step
2004 Ward World ChampionshipsCelebrate wildlife carving with winners of the world-class competition in Ocean City, Maryland. Don't miss the 2005 event set for April 22-24.WCI Staff29Holiday200434-35ChampionshipsWard Museum Wildlife
Sleeping Chickadee Christmas OrnamentNestled in the branches of a Christmas tree, This bird-carving project is perfect for that ''Silent Night''.Russell, Frank C29Holiday200437-42OrnamentsBirdsHolidays
Edible ArtNow you're cooking! Gene Wilson's carved wooden cookie molds: includes authentic recipes.Weinstein, Mark29Holiday200444-47Cookie MoldsRecipesKitchen
Gifts for CarversA gift for any budget. Check out the latest and greatest.WCI Staff29Holiday200449-52Gift IdeasToolsBudget
The 4th Annual Woodcraft Santa ContestBruce Futterer's Santa with Toboggan wins from a talented field of 147 entries.Weinstein, Mark29Holiday200453-57SantasContestsHolidays
Carve a ShellSix Easy Steps to this classic furniture carving details.Schroeder, RogerBelisle, Bill29Holiday200459-63FurnitureStep by stepHome Decor
Whittling a Miniature FlowerPro whittler, Chris Lubkemann's latest quick & easy project.Lubkemann, Chris29Holiday200465-66WhittlingFlowersMini
Peeking Santa OrnamentYou'll have fun quickly creating ths project to hang on your tree or to surprise friends with.Nelson, John29Holiday200467-69Step by StepSantasOrnamentsHolidays
Finishing The Bulldog Buttetin Board - Part 2 - PaintingAdd special touches to your carvings.Wise, Kathy29Holiday200471-75Step by StepPainting TechniquesAnimalsDogs
Print Your Own Holiday CardsAdapt traditional block printing methods and carve your own holiday card design.Duncan, Bob29Holiday200476-79HolidaysStep by StepCards
All About Drawknives, Spokeshaves & ScorpsExplore these traditional cabinetmaking tools and how they can make a carver's life easier.Schroeder, Roger29Holiday200481-84ToolsTool ReviewsFurniture
Relief ColumnHome Sweet Home PatternIrish, Lora S30Spring200514BirdsRelief CarvingHome Decor
Swiss WoodcarvingsThese classic Swiss carved bears show a variety of ways to showcase a carving in your home.Shenk, Emily30Spring200518-19AnimalsBearsWildlife
Wildlife Carving Contest WinnersWood Carving Illustrated, Woodcraft Supply, announce winners of 2004 contest.WCI Staff30Spring200520-23ContestsWildlifeWoodcraft
Chip Carve a Classic Spoon RackUsing a few simple tools, assemble, carve and finish an antique replica.Douglass, Tom30Spring200524-27SpoonsChip CarvingPainting Techniques
Gunnar The VikingAdd-ons make this fierce warrior caricature a great looking project.Hull, Joel30Spring200528-33CaricaturesPeoplePattern ProfileProjects, Step by Step
Carving in Live TreesLearn how to carve a wood spirit in a tree without killing it.Patridge, Colin30Spring200534-40Wood SpiritsLive Edgetechnique
Koch Shapening System Put to the TestGerman sharpening system promises to never burn your tools-ever!Schroeder, Roger30Spring200541-43SharpeningToolsProduct Review
Carve a Realistic Decoy Duck CallA fresh look on classic realistic decoy duck carving techniques creates a collectable call.Herbert, Del30Spring200544-49Projects, Step by StepDucksDecoysPattern Profiles
Wood Spirits and Green MenLora S. Irish, Shawn Cipa and Chris Pye share on carving wood spirits--common and uncommon.Irish, Lora S30Spring200550-52Wood SpiritsBook ExcerptsGreen Men
Cutthroat TroutGordon Stiller shares his pattern for a realistic trout.Stiller, Gordon30Spring200552-53FishPattern ProfilesRealistic
Schimmel's CarvingsCarve a tiger in a turn of the century folk art style.Duncan, Bob30Spring200554-59AnimalsTigerProjects, Step by StepPattern Profiles
Carving The Human EarA detailed look at the human ear.Russell, Frank C30Spring200560-63EarsTechniquesRealistic
Bald Eagle ''Majesty''Power carve this enduring symbol of freedom, Part 1 or 3.Merkle, Cam R30Spring200564-70Step by StepPattern ProfilesBirdsPower Carving
Observation Leads to InspirationCarver John Faye finds inspiration in day-to-day life.Weinstein, Mark30Spring200571PeopleNatureArtist Profile
Best In ShowWCI introduces Judges Critique feature with judge's comments from the 2004 AWC International Congress in Davenport, Iowa.WCI Staff30Spring200572-73Judge's CritiqueCongressHighlights
String Buffer and De-FuzzerWCI announces Second Poor Man's Tool Contest winner.Twilbeck, Edward30Spring200574-75ContestsProduct ReviewWinner
2004 International carver's ConferenceHighlights from the conference held in Kitchener, Ontario Canada.Duncan, Bob30Spring200576Carver's ConferenceHighlightsGallery
Judge's CritiqueDull Tools: a challenge for relief carvers.Judt, Bill (W.F.)31Summer200514Judge's CritiqueRelief CarvingTools
Wayne Barton Named WCI Woodcarver of the YearChip Carver, Wayne Barton, Honored for his commitment to carving.WCI Staff31Summer200517Carver Of The YearWinnerArtist Profile
John C Campbell Folk SchoolIs there a summer camp for carvers? Students and teachers alike reminisce about the time they spent at the school.Duncan, Bob31Summer200518-19SchoolFolk ArtCarving Resources
Dimensional WoodburningAdd depth and contrast to your woodburning with this lesson in tonal values.Irish, Lora S31Summer200520-23WoodburningPyrographyTechnique
A Day at the BeachInnovative inlay techniques add interest to this award-winning carving.Bedel, Ken31Summer200524-27BirdsPenguinsPattern Profile
Carve a Spirit LureYou don't want to lose this lure in a snag! Combine carving, woodburning, and painting to make your own fishing lure.Fishgap, Alfie J31Summer200528-32FishingPattern ProfilesProjects, Step by Step
Modern Ivory CarvingFrom billiard balls to beef bones--Alternative sources for ivory give carvers another material to work with.WCI Staff31Summer200533Book ExcerptsScrimshaw
Carve and Paint a Feather PinIncrease your confidence with this project that's designed to build your detailing skills.Kochan, Jack31Summer200534-37Pattern ProfilesProjects, Step by StepFeathersPins
Woodburn Realistic FurAdd woodburned texture to a carved mouse for a realistic fur effect.Hajny, Desiree31Summer200538-39TexturesAnimalsMouse
Painting a Realistic Duck Head CallAdd the perfect finishing touch to your carved duck call by mixing your own paints.Herbert, Del31Summer200540-43BirdsDucksPainting Techniques
Pyrography Gallery: Burning Realistic TextureWith the right nib and technique, it's easy to add realistic texture to your carvings.Walters, Sue31Summer200544-50PyrographyWood BurningTextures
Flexcut's RPC Put to the TestRough out carvings in half the with the new addition to the Flexcut product line.Duncan, Bob31Summer200551ToolsRough outProduct Review
Chip Carve a BorderAccent a multitude of projects with this traditional pattern.Moor, Dennis31Summer200552-53Chip CarvingHome DecorProjects
Bald Eagle ''Majesty''Detail a carved eagle with power tools and a woodburner for realistic texture. Part 2 of 3.Merkle, Cam R31Summer200554-59Step by StepBirdsPower Carved
Stubai Carving Tools Put to the TestWhen it comes to holding an edge, Austrian-manufactured carving tools just keep cutting.Schroeder, Roger31Summer200560-61Tool ReviewsToolsProduct Review
SongbirdsMake your own feet and learn proper paint blending techniques to add realism to carved songbirds.Corbett, Lori31Summer200562-65BirdsBook ExcerptsRealistic
Stalking WolfCarve a classic wolf with this quality pattern from Gordon Stiller.Stiller, Gordon31Summer200566-67Pattern ProfilesAnimalsWolves
Carving a Mechinical Cork StopperCarve and assemble a head-bobbing, fiddle-playing cork stopper with a few simple tools.Sabol, David31Summer200568-76Pattern ProfilesProjects, Step by StepCaricaturesBottlestoppersPeople
Wood ToxicityThe top 26 most dangerous woods to work with.Self, Charlie31Summer200578Book ExcerptsWood ReviewsSafety
Relief ColumnInlet LighthouseIrish, Lora S32Fall200514LighthouseRelief CarvingSeaside
Sharpening SimplifiedProduct ReviewStaff32Fall200516SharpeningVideoProduct Review
Soff JawsProduct ReviewStaff32Fall200516ClampsProduct ReviewTools
Carving and Painting a Pansy Jar LidHand carve and paint this charming addition to your homePhillips, Charley32Fall200521-25FlowersPansyJar Lid
Hand Sharpening Made SimpleTips for keeping your carving tools razor sharpMignone, JohnSchroeder, Roger32Fall200526-29SharpeningToolsTips
Native American ChiefCapture emotions in less than 2'' of woodTroutman, Dean32Fall200530-32Native AmericanIndiansRelief Carving
Branson: A Carver's ParadiseOzark tradition of carving makes this Missouri hot spot a great vacation destinationStaff32Fall200533-35Valley Road WoodcarversEngler DesignsVacationMissouri
Woodcarver of the Year - Wayne BartonWCI honor Swiss-trained carver, credited with the resurgence of chip carving in the US, and visits his one-of-a-kind kitchenDuncan, Bob32Fall200536-39Chip CarvingClockWoodcarver of the YearWayne Barton
In the Best Light Photographing Your ArtworkAffordable tips and techniques for better quality photosStaff32Fall200540-43PhotographyTipsCamera
Fantasy Wizard's StaffA spellbinding project that is easier to carve than it looksCipa, Shawn32Fall200544-49StaffWalking StickWizard
Carving a Rustic Picture FrameRecreate this historic style-frame in a more modern sizeWilbur, Frederick32Fall200550-54Picture frameRusticHome Decore
The Humorous World of Pete LeClairTry your hand at ''Blake,'' a classic pattern from CCA member Pete LeClairSchroeder, RogerLeClair, Pete32Fall200555-57BlakeCaricaturesArtist Profile
Quick Carve SpreaderCarve this useful utensil out of a branch using only a pocketknifeLubkemann, Chris32Fall200558-59SpreaderWhittlingPractical
The Ward World Championship''Wow'' seemed to be the most common statement by visitors to the 2005 Ward World Championship held in Ocean City, MDStaff32Fall200560-61Ward World ChampionshipBirdsGallery
Bald Eagle ''Majesty''Painting the Bald Eagle, Part III of IIIMerkle, Cam R32Fall200562-66EagleBirdsPainting Techniques
Port-A-StropBattery powered honing tool makes it easy to keep a razor edge while on the goDuncan, Bob32Fall200567SharpeningProduct ReviewPut to the test
Miss ScarlettFlowing lines and rich colors add elegance to Gone with the Wind heroineBoyd, Carol Jean32Fall200568-69Cypress KneesFemaleMovie Icon
Gouge Sharpening ExerciseUse wood molding to practice sharpening techniques, before you work on your toolsBreau, Andre32Fall200570-71SharpeningGougeTechnique
Maple Leaf EarringsA popular gift item, these earrings a great way to brush up on your carving skillsVermillion, KennySaathoff, Carl32Fall200572-77EarringsMaple LeafPower Carving
Capturing Movement in WoodThe work of sculptor Fred ZavadilMoor, DennisZavadil, Fred32Fall200578-79SculpturesMovmentFred Zavadil
The Traditional European-Style Carving KnifeAppreciating a good, inexpensive tool can change your techniques for the long runFairchok, Andy32Fall200596KnifeEuropean-StyleTeacher's Corner
Relief ColumnEasy-to-Carve whimsical patternsIrish, Lora S33Holiday200514SnowmanSantaRelief Carving
Woodcarving at the National Scout JamboreeIntroducing 50,000 boys a year to the joys of carving through the merit badge programSheilds, Gregg33Holiday200518Boy ScoutsJamboreeCelebration
The Erzgebirge Carving TraditionCarving out a living - and a few walnut shells - in the mountains of GermanyGingerich, Bob33Holiday200520Walnut ShellsMiniatureGermany
Heirloom Alphabet BlocksCarve these traditional letter blocks as a timeless toy or classic decorationWilbur, Frederick33Holiday200522-25LettersAlphabetBlocks
Tapestry SantaCopper highlights and floral details make this Santa stand out in a crowdToney, Tina33Holiday200526-28SantasCopperFloral
Saint Nick Cane TopperCarve and paint this great holiday gift in a weekendBishop, Phil33Holiday200529SantasCane TopperBottle stopper
Art of Chainsaw CarvingStaffGroeschen, Jessie33Holiday200530-31Chainsaw CarvingPower ToolsArtist Profile
Quick and Easy Santa OrnamentsCreate a sleigh full of ornaments with these simple step-by-step instructionsJoslyn, Cyndi33Holiday200533-37SantasOrnamentsSleigh
Black-Throated Blue WarblerProject pattern from Stiller PatternsStiller, Gordon33Holiday200538BirdsSongbirdsRealistic
Christmas Past SantaCapture a bit of old-time holiday spirit with this nostalgic carvingWillis, Jim33Holiday200540-42SantasChristmasCaricatures
Beginner Tool SetsA few expert suggestions for starting your carving tool collectionSchroeder, Roger33Holiday200543BeginnerToolsProduct Review
''Big Red'' SantaBreak out of the ordinary and share a smile with this fun-to carve, whimsical fellowGall Sample, Alison M.33Holiday200544-46SantasCaricaturesChristmas
The 5th Annual Woodcraft Santa Contest sponsored by Wood Carving IllustratedMore than 150 Santas competed for the title of 2004 Woodcraft Santa of the yearDuncan, Bob33Holiday200548-52SantasWoodcraftContests
One-Stop Finishing StationBrice, John33Holiday200554-55AccessoriesPaintingFinishing
Tips for Large CarvingsGunderson, Elmer33Holiday200556-57Large CarvingsTipsTechnique
Tabletop Carving Bench and MagnifierWheatley, Melvin33Holiday200558AccessoriesPoor Man's ToolContests
Cowboy SantaSanta visits the Wild West in style with this fanciful take on the classic holiday iconSears, Gerald33Holiday200559-61SantasCowboyCaricatures
Creative Carving SolutionsInspiration comes by thinking out of the boxLaBranche, Bud33Holiday200562-63SolutionsProblemsTips
Marching Toy SoldiersWith figures that are easy to carve, it's simple to create a battalion to march through the holidaysBarto, Renzo33Holiday200564-66Toy SoldiersHolidayCaricatures
Chip Carved Leaf OrnamentsThe small size of these ornaments - and the simple tool list - makes them great projects for carvers on the goMckenzie, Barry33Holiday200567-69Chip CarvingOrnamentsLeaf
Miniature Chickadee PinThis charming project can be power carved and painted in one weekendCalef, George33Holiday200570-72PinsBirdsSongbirdChickadeePower Carving
Celtic Cross Bible BoxOnly a few basic tools are needed to carve this classic designCruze, Wayne33Holiday200574-77Celtic KnotworkCrossBible Box
Twisted Spiral OrnamentCarve this seemingly complex design in eight easy stepsKent, Carol33Holiday200578-79SpiralOrnamentsWhittling
Santa Spiral OrnamentAdd a new twist to a classic Santa OrnamentWatts, Lenard33Holiday200580SantasOrnamentsSpiralCarver's Challenge
Wood Review Spanish CedarSchroeder, Roger33Holiday200582Spanish CedarWood ReviewsInfo
Quick and Easy NoseSix easy steps for consistent resultsOegema, Jan33Holiday200596NoseRealisticTechnique
Product ReviewForedom Series SR flexible shaft tool and Foredom Bristle DiscsDuncan, Bob34Spring200614foredom seriesflexible shaft toolforedombristle discs
Judge's CritiqueUse references to achieve high realism in your carvingsHajny, Desiree34Spring200618OtterWildlifeAnimals
Relief ColumnRooster & HenIrish, Lora S34Spring200620-21RoosterHenEggsRelief
Carving on a Large ScaleLarge carvings are an impressive challenge to any carver's art and skillsBurton, Mike34Spring200622-26PatternsFemaleLogSurprisesPitch
Harlequin DuckProject pattern from Stiller PatternsStiller, Gordon34Spring200628-29BirdsDucksHarlequin
All About Clamps & VisesEssential hardware to aid your carvingSchroeder, Roger34Spring200630-31ClampsVisesHolding
Art of Fire with Bob SwainCreate a worn, antiqued look for your carvings by finishing with flamesBadger, CurtisBadger, Tom34Spring200632-35BirdsAntiqueFireFinishing
Floral Chip CarvingsCreate your own custom basket lids or carve a traditional plaque with these delicate designsJanssen, Darrell34Spring200636-38FlowersChip CarvingBasket lidsPlaquesWildflowers
Carving Out a Place in the WorldBuilding a business around custom-carved furnitureMcCoury34Spring200639DragonFurnitureMantle
Carver's LapboardNo room in the house is off limits with this portable carving station made from scrapBrown, Charles34Spring200640Poor Man's Tool ContestPortableStation
Catch and Release?Use simple texturing techniques to detail this whimsical carvingFenton, Gary34Spring200641-43BearFishCaricatures
Contemporary Carved HeartsQuick and easy projects make eye-catching pins or magnetsJoslyn, Cyndi34Spring200644-45HeartsPinsMagnets
The Sculpture of Tom BazisUnique carvings crafted for individual clientsLambert, GustaveBazis, Tom34Spring200646Rocking ChairSculptureAbstractMaskWet Wood
Carving a Half Hull Ship ModelUse traditional carving techniques to create a scale model of the historic ship ''Raven''Squarebriggs, Robert34Spring200648-55Ship ModelHalf HullRaven
The Whimsical World of David SabolCCA member strives for a lighthearted lookSchroeder, RogerSabol, David34Spring200656-57CaricaturesAnimalsArtist Profile
Shop-Made Rotary Carving ViseCreate this clever, hold-anything vise for less than $30Burton, Mike34Spring200658-61ViseHome-made toolsSoldering
Hollow Core MuskieCreating a hollow core helps keep large carvings manageableWeiss, CharlesWeiss, George34Spring200662-63FishMuskieTrophyHollow Core
Realistic Eagle BustDesigned as a cane topper, this majestic eagle could easily be enlarged for a full-size carvingMoore, Pat Mikula34Spring200664-69EagleCane TopperWalking StickBirds
Antique-Style Decoy CarvingCreating modern decoys with vintage appealMatus, Tom34Spring200670-73DucksAntiqueEyeBirds
Jenga Block BearSimple tools and materials can produce great resultsRussell, Lavonne34Spring200674Carver's ChallengeBearsProduct Review
Simple Carved DaisyEasy techniques for enhancing your carvingYurka, John34Spring200676-77DaisyFlowersHabitat
Miniature Carving on a Grand ScaleExploring the similarities and differences between miniature and traditional carvingMcCaffery, Lloyd34Spring200678-79Ship ModelMiniatureNative American
International Woodcarvers CongressA gathering of today's top carvers34Spring200680-81DavenportContestsHighlights
Lacewood RosebowlDelicate details from nature adorn this hand carved gift fit for royaltyPye, Chris34Spring200682LeavesBowlWren
Quick and Easy MouthCreate a mouth in five easy stepsOegema, Jan34Spring200696TipsMouthRealistic
Woodcarving BasicsA brief introduction to the tools and terms of carving woodStaff341Ultimate Carving Patterns Vol. 1200638886ToolsCutsTypesWoodSafety
Uncle SamShipley, MikeKochan, Jack341Ultimate Carving Patterns Vol. 1200620-21CaricaturesPatrioticUncle Sam
Rock SingerLeclair, Pete341Ultimate Carving Patterns Vol. 1200622-23CaricaturesSingerMusician
Scandinavian BackpackerRefsal, Harley341Ultimate Carving Patterns Vol. 1200624-25CaricaturesHikerScandinavian
PirateJohnson, SkylarKochan, Jack341Ultimate Carving Patterns Vol. 1200626Caricatureseye patchEggs
BogieLeclair, Pete341Ultimate Carving Patterns Vol. 1200627CaricaturesHeadTechnique
Keystone CopToney, Tina341Ultimate Carving Patterns Vol. 1200628-29CaricaturesPolicemanRealistic
ChickenToney, Tina341Ultimate Carving Patterns Vol. 1200630CaricaturesBirdsEggs
Eagle BustKochan, Jack341Ultimate Carving Patterns Vol. 1200632-33BirdsEaglesOpen Mouth
Ringneck Drake DecoyLucio, Jason341Ultimate Carving Patterns Vol. 1200634-35BirdsDucksDecoys
Scarlet MacawStiller, Gordon341Ultimate Carving Patterns Vol. 1200636BirdsParrotCaricatures
Spotted SandpiperStiller, Gordon341Ultimate Carving Patterns Vol. 1200637BirdsShorebirdRealistic
Hooded MerganserStiller, Gordon341Ultimate Carving Patterns Vol. 1200638BirdsDucksDecoys
Cougar and CubsHajny, DesireeKochan, Jack341Ultimate Carving Patterns Vol. 1200640-41RealisticAnimalsCougar
Scratching DonkeyHajny, DesireeKochan, Jack341Ultimate Carving Patterns Vol. 1200642-43RealisticAnimalsDonkey
Carousel HorseSharp, PatEllis, BudKochan, Jack341Ultimate Carving Patterns Vol. 1200644-45RealisticAnimalsHorsesPhiladelphia Toboggan Company
Bison BookendsGreen, Don341Ultimate Carving Patterns Vol. 1200646-47RealisticAnimalsBisonBuffaloBook ends
Native AmericanCipa, Shawn341Ultimate Carving Patterns Vol. 1200649-51Plains-Style TribeIndiansCoupe Stick
Spirit LureFishgap, Alfie J341Ultimate Carving Patterns Vol. 1200652Fishing LureNative AmericanIndian
Goodbye KissJensen, RickKochan, Jack341Ultimate Carving Patterns Vol. 1200654-57SantasMrs. ClausHoliday
Snowflake SantaShipley, MikeKochan, Jack341Ultimate Carving Patterns Vol. 1200658-59SantasHolidayCaricatures
Droopy Hat SantaCipa, Shawn341Ultimate Carving Patterns Vol. 1200660-61SantasHolidayCaricatures
Welcome SantaToney, Tina341Ultimate Carving Patterns Vol. 1200662-63SantasWelcomeHome Decor
My Lil GoblinJoslyn, Cyndi341Ultimate Carving Patterns Vol. 1200664GhostHalloweenTrick or Treat
Quilt SquaresJoslyn, Cyndi341Ultimate Carving Patterns Vol. 1200664Relief CarvingPinsQuilt
Old Saw MillTroutman, Dean341Ultimate Carving Patterns Vol. 1200665Relief CarvingLandscapeWinter
Covered Bridge SceneTroutman, Dean341Ultimate Carving Patterns Vol. 1200665Relief CarvingLandscapeBridge
Celtic KnotworkCruze, Wayne341Ultimate Carving Patterns Vol. 1200666Relief CarvingCelticKnotwork
Celtic HeartsCruze, Wayne341Ultimate Carving Patterns Vol. 1200667Relief CarvingCelticKnotworkHearts
Rustic Barn SceneIrish, Lora S341Ultimate Carving Patterns Vol. 1200668-69Relief CarvingLandscapeBarn
Bank Barn SceneIrish, Lora S341Ultimate Carving Patterns Vol. 1200670-71Relief CarvingLandscapeBarn
WoodspiritJohnson, Skylar341Ultimate Carving Patterns Vol. 1200672StaffWalking StickWoodspirit
Dove Peace CrossMoor, Dennis341Ultimate Carving Patterns Vol. 1200674DoveCrossChip Carving
RosetteMoor, Dennis341Ultimate Carving Patterns Vol. 1200675Chip CarvingClassicPattern
Mangle BoardMckenzie, Barry341Ultimate Carving Patterns Vol. 1200676-77Chip CarvingOld WorldHorses
Angel OrnamentsMckenzie, Barry341Ultimate Carving Patterns Vol. 1200678Chip CarvingAngelsOrnaments
Foredom 50C Reciprocating HandpieceProduct ReviewKochan, Jack35Summer200614Product ReviewsForedomReciprocating Carver
Judge's CritiqueProgression of skills is evident in series of carvingsIrish, Lora S35Summer200616DragonCritiqueTips
Relief ColumnPintail Duck in CattailsIrish, Lora S35Summer200618DucksRelief CarvingScenic
Sculpting Raptors with Greg WoodardCreating striking realism through a thorough knowledge of your subject matterRyan, KathleenWoodard, Greg35Summer200620-23RaptorsBirdsBirds of preySculpture
Custom Honing BoardThis easy-to-make shop aid is a great way to keep your gouges and V-tools in tip-top shapeIrish, Lora S35Summer200624-25SharpeningHoningShopmade
Relief Carved Sunflower ClockSimple techniques for a functional floral projectPhillips, Charley35Summer200626-31FlowersClockRelief Carving
Carving Classic BookendsMaster architectural details by tackling the project in distinct sectionsWilbur, Frederick35Summer200632-39BookendsArchitecturalAcanthusScales
Wood EngravingCreate detailed prints from carved woodWalker, George35Summer200640-43PrintTreeEngraving
Carving in the European-StyleAustrian-based school carries on the art of traditional European carvingStaffGeisler-Moroder35Summer200644-45HeadBustEuropeanKrampusGeisler-Moroder
Fruit Pit CarvingsAmazing details in miniature carvingsShamey, Bob35Summer200646-47PitsUnusual MaterialsMiniatures
Colorful Chip Carved PlaqueUse subtle color to highlight the details in this commemorative plaqueNiggemeyer, John35Summer200648-51Chip CarvingColorBaby announcementPlaquesAngel
Magical Fairy Keepsake BoxDelightful carving makes a thoughtful giftCall, Deborah L.35Summer200652-59FairyQuiltBoxFolds
Custom Carved Hunting CredenzaHand carved details bring a client's vision to lifeMccoury, BrianEvans, DavidCochenour, Bill35Summer200660-63ShotgunCredenzaGun
Carving Realistic HabitatPower carve a simple curled leaf to add depth and realism to your workSabol, David35Summer200664-69LeafAcornPower CarvingHabitat
MuskellengePattern project from Stiller PatternsStiller, Gordon35Summer200670-71FishMuskiePattern
Quick and Easy Ozark CaricatureSimple cuts bring this country caricature to life in no timeShipley, Mike35Summer200672-77CaricaturesOzarkHillbilly
Shop-Made Holding DevicesInexpensive methods for holding irregularly shaped carvingsSchroeder, Roger35Summer200678-79ViseCarver's FrameSandbagRope clampBench hook
Paint Mixing Record ChartTeacher's CornerCorbett, Lori35Summer200695-96PaintingRecordsChartPaint mixing
Product ReviewMastercarver Stealth Handpiece and Dremel StylusDuncan, Bob36Fall200614mastercarverstealth handpieceDremelrotary toolhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Judge's CritiqueWrenCorbett, Lori36Fall200616BirdsWrenCritiquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Relief ColumnAutumn MouseIrish, Lora S36Fall200618Relief CarvingMouseLeaveshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Easy Carved SpoonsIdeal for introducing carving to beginners or whittling away an afternoonCourtea, Fran36Fall200622SpoonsKidsCarver's Challengehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Maple Leaf PinPower carve and paint this charming seasonal broochVermillion, KennySaathoff, Carl36Fall200626-32LeavesPinsPower Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Brown PelicanStiller PatternsStiller, GordonStiller, Marsha36Fall200634-35WaterfowlBirdsPelicanhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
It's Me FrankMonster caricature is a treat to carveBishop, Vicki36Fall200636-39FrankensteinCaricaturesHalloweenMonsterhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Carving a Hen Wood DuckBasic tools and techniques for an authentic antique-style hunting decoyMatus, Tom36Fall200640-45DecoyDucksBirdsWaterfowlWood Duckhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Marvin Kaisersatt - Woodcarver of the YearDuncan, BobKaisersatt, Marvin36Fall200646-49CaricaturesWoodcarver of the Yearhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Relief-Carved Horse PortraitClassic portrait makes a bold statementTroutman, Dean36Fall200650-54Relief CarvingHorseArrowheadFeathershttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Anthony Hillman's Passion for Carving WaterfowlTurning your interests into a career can be very rewardingDuncan, BobHillman, Anthony36Fall200655-57BirdsHillmanWaterfowlDuckhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Patchwork ClockEasy-to-Carve clock is a great beginner projectJoslyn, Cyndi36Fall200658-63ClockBeginnersPainting Techniqueshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Chip-Carved Wedding PlateDecorative, personalized plate makes a beautiful wedding giftMckenzie, Barry36Fall200664-67Chip CarvingPlatePersonalizedWedding gifthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Tools of the TradeAn introduction to the tools used in traditional woodcarvingPye, Chris36Fall200668-73BeginnerToolsChiselsGougeshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Halloween WitchCreate this folk-style carving using only a hobby knifeCostanza, Anthony36Fall200674-78WitchAdd-onsCaricaturesHalloweenhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Carve a HoboA few tools, some paint, plus a little time gives this American iconMaxwell, JimMaxwell, Margie36Fall200680-85HoboCaricaturesTipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
The Work of Frank FeatherTraveling carver leaves a lasting and valuable legacyMeyers, Shawn36Fall200686HoboAntiqueEyehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Quick and Easy Folk Art EyeCarve an eye in five simple stepsOegema, Jan36Fall200696Teacher's cornerEyeFolkHumanhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-36-fall-2006.html
Product ReviewOlson 3/32'' Bandsaw Blades, Jones Handy Handle, and Style-Line Corp. Soft SandersDuncan, Bob37Holiday200614Olsonbandsaw bladesjones enterprisesjones handy handlestyle-line corphttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Judge's CritiqueFolk Art SantaCipa, ShawnGoodman, Harold37Holiday200616SantasCritiqueFolk Arthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Relief ColumnWinter CardinalIrish, Lora S37Holiday200618BirdsCardinalRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Northern CardinalStiller, Gordon37Holiday200620-21BirdsPattern ProfilesCardinalhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Happy SantaThe compact styling of this smiling fellow makes him an ideal project for beginnersToney, Tina37Holiday200624-26SantasPattern ProfilesJollyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Chip Carved Golf BallsDisplay these striking ornaments individually or in their own custom cage clockBraunberger, SharonDugan, Elaine37Holiday200628-31Golf ballsClockChip CarvingCageOrnamentshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Santa ClausClassic Santa face makes a perfect winter welcomeRamsay, Les37Holiday200632-37SantasFaceRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Rolling Caricature AnimalsEasy-to-carve critters are delightfully mobileHajny, Desiree37Holiday200638-45HorseBisonElephantCaricaturesAnimalshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Santa with CardinalWood bleach techniques make painting a snapBishop, Vicki37Holiday200646-48SantasBleachCardinalBluehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Tuning Your ToolsThe basics of getting your tools into the best condition for carving and keeping them therePye, Chris37Holiday200649-53SharpeningBevelAnglehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Folk Art Angel Tree TopperHand carve an instant family heirloomCipa, Shawn37Holiday200654-59AngelsRelief CarvingTree-topperStarhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
The Art of Ken NewmanSculpting respect for wood and natureNewman, Ken37Holiday200660-63GalleryWildlifeNatureSculpturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
2005 Santa Carving ContestWayne Shinlever's Santa takes home the top prizeDuncan, Bob37Holiday200664-69SantasContestsWoodcrafthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
A Christmas Story Leg LampNostalgic lamp will become and instant conversation starterBurton, Mike37Holiday200670-74LampLegLightChristmas Storyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Painting a Hen Wood DuckUse blending techniques for an antique-style finishMatus, Tom37Holiday200675-77DucksdecoyPainting TechniquesAntiquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Chip Carved Angel OrnamentsCarve through painted blanks for an easy, yet beautiful projectMckenzie, Barry37Holiday200678-79AngelsChip CarvingOrnamentsChristmasPaintedhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Santa Lamp FinialA charming way to show off your seasonal carvingsBrown, SteveFulks, Judy37Holiday200680-83SantasFinialLamphttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Herby's AngelEasy-to-carve figure is a Holiday delightMcLeod, PaulHam, Herby37Holiday200684-85AngelsBeginnersBookRoughouthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Teacher's CornerQuick and Easy EarOegema, Jan37Holiday200696EarFolk ArtFacial featureshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/wood-carving-illustrated-issue-37-holiday-2006.html
Product ReviewJoolTool Sharpening SystemMatus, Tom38Spring200714JoolToolProduct ReviewToolshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Largemouth BassJudge's CritiqueMcKenzie, RayArchie, Al38Spring200718FishCritiquebasshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Relief ColumnMaple Leaf GreenmanIrish, Lora S38Spring200720GreenmanRelief CarvingleavesWoodspirithttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Celebrating 15 Years of Craftsmanship in WoodOpen HouseStaff38Spring200722-23Woodcarver of the YearClassesTotemChainsawhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Carved Garden ChairCustomize this sturdy chair with your own relief carved designOegema, Jan38Spring200726ChairFurnitureRelief CarvingGreenmanWoodspirithttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
The Design ProcessTaking a caricature from concept to completionKaisersatt, Marv38Spring200728-29CaricaturesDesignArmaturePipecleanersClayhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Chip Carved LandscapeFree-form chip carving enhances natural wood grainMckenzie, Barry38Spring200730-31Chip CarvingTreeLandscapeFreeformbirdshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Realistic RabbitTexturing techniques bring this adorable rabbit to lifeWachter, Leah38Spring200732-37RabbitFurTexturesbunnyhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
GM's Fisher Body Craftman's GuildCarving out a career in the design world - 1950's styleJacobus, John38Spring200738-41CarsAutomobileModelsContestDesignhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Recreating a MasterpieceTurn-of-the-century table inspires a life-long love of carving three generations laterJones, Jeff38Spring200742-43TableGriffonWingsAntiquehttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Carving the Ball & ClawSequential carving helps you duplicate this traditional furniture elementBurton, Mike38Spring200744-47FurniturefootBall & ClawLeghttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Native American BustPortraying character with distinctive facial featuresGargac, Mark38Spring200748-55IndianNative AmericanBottle stopperBustHeadhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Hand Carved ClassicsPractice your knife carving with chain links and a ball-in-cageWeaver, Kivel38Spring200756-57ChainBall in cageWhittlinghttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Cottonwood Bark VikingRugged features make this warrior the perfect subject for bark carvingJensen, RickDraper, Monte38Spring200758-63Bark CarvingVikingFaceHornshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
The Netsuke Carvings of Cornel SchneiderDetailed carvings demonstrate a love of natureSchneider, Cornel38Spring200764-67FrogsLizardsMiniaturesNetsukeviolinhttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Setting Up ShopA carver needs more than sharp tools; the workspace, bench, and lighting are equally importantPye, Chris38Spring200768-73WorkshopWorkstationHolding deviceswoodTools and equipmenthttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Carving Habitat: TwigPower carve highly detailed branches tailored to showcase your carvingVermillion, KennySaathoff, Carl38Spring200774-77HabitatTwigBranchPower Carvinghttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Antler Sculpture by Bill MatzFacsinating medium produces unique carvingsMatz, Bill38Spring200778-80AntlerMooseWildlifePower Carvinghttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Relief Carve a Whimsical HousePower tools speed up the carving process and add unique textureCline, Jim38Spring200781-85Relief CarvingHouseTreesTexturePower Carvinghttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Clean Joint Lines for Relief CarversTeacher's CornerIrish, Lora S38Spring200796Relief CarvingJointsTipshttp://foxchapelpublishing.com/wood-carving-illustrated-issue-38-spring-2007.html
Product ReviewJerry-Rig 360º Mount and Henkel Consumer Adhesives PL Fix 2-part wood repair kitPye, ChrisDuncan, Bob39Summer200714Jerry Rigwork positionerHenkel Consumerwood repair kithttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Relief ColumnEagle PlaqueIrish, Lora S39Summer200716Relief CarvingEaglesPlaquePersonalizedhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Carving Wooden EggsThe Grand Old Flag EggTudor, Linda39Summer200721-24Relief CarvingEggsFlagsStarshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Preserving the PastThe rise, fall, and rebirth of carved carousel horsesDuncan, Bob39Summer200726-32CarouselCommunityHistoryHorseshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Carving Habitat: MushroomAdd realism to your wildlife carvings or carve this mushroom as a stand alone pieceVermillion, KennySaathoff, Carl39Summer200734-37Power CarvingMushroomHabitathttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Tool ControlProper techniques for safe and efficient usePye, Chris39Summer200738-43Low angle gripHigh angle gripBasic gripsHoldinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Mississippi AlligatorStiller PatternsStiller, GordonStiller, Marsha39Summer200744-45AlligatorPattern ProfilesAnimalsWildlifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Stylized Grizzly BearSimple lines capture the essence of the animal without hours of detailingWinn, Kelly39Summer200746-49BearStylizedGrizzlyAnimalsWildlifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Personalized Love SpoonPattern template makes production carving easyGledhill, Jim39Summer200750-54Love spoonCelticGemsReliefPersonalizedhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Realistic Sanderling Painting TemplatesThese easy templates crete a flawless finishHerbert, Del39Summer200755-57BirdsShorebirdFeathersPaintinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Elf Country Stylized MaskCombine realistic facial features with stylized techniques for a striking displayCacioppo, LouCook, Mary39Summer200758-64MaskElfStylizedHumanhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Duck TonightFacial expressions and body language let you tell a story with your carvingSmith, Arnold39Summer200765-67CaricaturesHunterDuckGunhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Sculpting in WoodTalented artist pays tribute to loved onesSager, Betty39Summer200768-69BustsHumanRealisticSculpturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
All About Buying WoodA handy reference guide and inside tips from 30 years of buying carving woodSchroeder, Roger39Summer200770-73WoodTypes of CutsSurfaced Vs. UnsurfacedWood DefectsNominal Measurementshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
First CutsA carver's journey to becoming a member of the Caricature Carvers of AmericaCaricature Carvers of AmericaCCA39Summer200774-77CaricaturesRhadigan, FloydStetson, DaveTravis, BobBrown, Tomhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Portable Carving StationA sturdy, shop-made workbench that folds up when not in useHaumesser, James M.39Summer200778-79WorkshopWorkstationBenchhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Teapot ClockCharming clock with chip-carved details is perfect for the kitchenMckenzie, Barry39Summer200780-85Chip CarvingClockSpoonTeapotPendulumhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
UndercuttingTeacher's CornerIrish, Lora S39Summer200796Relief CarvingUndercuttingShadowshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-39-summer-2007.html
Product ReviewWork Sharp Sharpening System WS 3000 and Preferred Edge Bent Pull KnifeDuncan, BobWilbur, Frederick40Fall200714Work SharpWS3000Preferred Edgebent pull knifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Relief ColumnAcorn ReliefIrish, Lora S40Fall200718Relief CarvingAcornPlaquePersonalizedhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Ivory Billed WoodpeckerStiller PatternsStiller, GordonStiller, Marsha40Fall200720WoodpeckerPattern ProfilesBirdsWildlifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Chip Carved LettersSimple block style is easy to carveMckenzie, Barry40Fall200722-23lettersTechniqueChip Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Laughing BearSimple cuts add texture to this happy fellowVillars, Jim40Fall200726-29CaricaturesBearStylizedhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Country Charm Quilt SquaresClassic fruit motifs are easy to carveIrish, Lora S40Fall200732-35Relief CarvingFruitLetteringhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
African ElephantWoodburning makes it easy to reproduce a leathery textureHajny, Desiree40Fall200737-43ElephantAfricanWildlifeWoodburninghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
First CutsA carver's journey to becoming a member of the Caricature Carvers of AmericaCaricature Carvers of AmericaCCA40Fall200744-47CaricaturesBishop, PhilFuller, GeneHayden, WillKaisersatt, Marvhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
English Renaissance CandlesticksRepeating design and traditional elements combine for a striking displayWilbur, Frederick40Fall200748-54CandlesticksTraditionalArchitecturalTurninghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Woodcarvers of the Year - Ed Gallenstein, Lora S. IrishDual award honors supporters of the carving communityIrish, Lora SGallenstein, Ed40Fall200755-59CommunityWoodcarver of the YearNWCACarving Patternshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Pipe DreamsCreating beautiful faux ivory carvings from PVC pipeCoker, Chuck40Fall200760-63PVC PipeFaux ivoryDragonPower Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Carving a Traditional Bowl & SpoonFunctional items showcase the beauty of woodBragg, David40Fall200764-69BowlSpoonTraditional carvingRustichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
The Wood Sculptures of Darwin DowerHistoric rural life captured in amazing detail40Fall200770-73RealisticRural ScenesPower Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Basic CutsMaster the five basic cuts to increase your carving efficiencyPye, Chris40Fall200774-79Running cutStabbing CutStop CutSweep CutSlicing cuthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Colorful Snake CaneCombine realistic and stylized elements for a striking projectDarnell, Ron40Fall200780-85RealisticSnakeCaneAirbrushPower carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
Painting SuppliesAccessories to help you paint successfullyRhodes, Vicki40Fall200796Teacher's cornerPainting suppliesBrushesPalletehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-40-fall-2007.html
2007 Santa Carving ContestPrize-winning entries and highlights from annual contest41Holiday200717-26SantasContestsWinnerhttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Pursuing a PassionTechnology enables blind artisan to continue carvingDuncan, Bob41Holiday200728-30BlindCarverLaserReliefhttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Woodcarving Hollywood StyleLocal artist teach Sissy Spacek to carve for her latest roleDuncan, Bob41Holiday200732-33ActorCarvingSissySpacekLegerhttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Simple Starter SantaBasic design makes a great beginner projectSchuck, Kathleen41Holiday200734-36SantaBeginnersSimplehttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Easy Evergreen PuzzleClever puzzle design is easy to makeSmith, Sandy41Holiday200738-40TreePuzzleSimpleOrnamenthttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Folk Art SantaAn antique finish gives Santa the look of a treasured heirloomJensen, Rick41Holiday200742-44SantaBarkwreathAntiquehttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Easy weekend nuthatch pinCreate a clock of feathered friends with basic power carving techniquesCalef, George41Holiday200746-47BirdNuthatchPinpower carvinghttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Olde World Santa OrnamentAdd texture and dimension with pierced relief techniquesGargac, Mark41Holiday200748-54SantaOrnamentPierceshttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Holiday Memories SantaQuick and easy carving produces a functional displayCipa, Shawn41Holiday200755-59SantaPicture holderFolkhttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Carving a Dogwood LeafPower carving technque for realistic habitatVermillion, Kenny41Holiday200760-64LeafDogwoodHabitatPower Carvinghttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Decorative floral sledVibrant colors and deep relief undercuts bring this piece to lifePhillips, Charley41Holiday200765-71PoinsettaSledflowerhttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
First CutsA carver's journey to becoming a member of the Caricature Carvers of America41Holiday200772-75CaricaturesEnlowLandenSearsYouhttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Simple carved moldingsUse basic cuts to create accents for frames and furniturePye, Chris41Holiday200776-81MoldingTraditionalTipshttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Delicate Pierced OrnamentsInnovative chip carving technique creates unique decorationsMckenzie, Barry41Holiday200782-84Chip CarvingOrnamentpiercedhttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Sharpening a V-toolLearn to tune this difficult-to-sharpen toolBerold, Charles41Holiday200796Teacher's cornerToolsV-toolSharpeninghttp://foxchapelpublishing.com/wci-issue-41-holiday-2007-retail.html
Product ReviewWoodcarving with Chris Pye, Vol. 1 Sharpening Techniques and Seyco's SeeSanderDuncan, Bob42Spring200814chris pyesharpening dvdSeycoseesanderhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Relief ColumnSpirit ChiefIrish, Lora S42Spring200816relief carvingnative americanprojecthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Classic Ball in CageThis old-time whittling project is fun to carve and a real attention-getterDussinger, Addison42Spring200819-21whittlingBall in cagewhimseyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
The Work of Joe WannamakerLate teacher shared his passion with a generation of carversDuncan, Bob42Spring200822-23WannamakerJoeCaricaturesGalleryhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Best of ShowAward-winning carvings from across the country42Spring200824-27CommunityContestsCCADavenporthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
First CutsA carver's journey to becoming a member of the Caricature Carvers of America42Spring200828-31CaricaturesLeclairHumphreysMorrillOttohttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Making Free-form Custom Wooden BoxesThis lesson in joinery and feeling the wood produces boxes that are a joy to hold and touchBurton, Mike42Spring200832-35BoxesJointsTechniquehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Line Carving: Three Simple StylesMaster the basics of drawing with a veinerPye, Chris42Spring200836-41Line carvingBullTechniquehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Express YoursefConvey emotions with exaggerated facial expressionsFarr, Jim42Spring200842-43CaricaturesExpressionsFaceshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
On the Wild Side with Jeffrey CooperQuality craftsmanship and wildlife carvings combine for deslightfully whimsical furnitureRyan, Kathleen42Spring200844-47AnimalsBenchesChairshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Elegant Oak Leaf Mantle ClockCreate a treasured family heirloom with easy positive-image chip-carving techniquesBarton, Wayne42Spring200848-51Chip carvingClockleaveshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Realistic Skin TonesSimple mixtures and techniques create a variety of flesh colorsIrish, Lora S42Spring200852-57Walking stickPaintFlesh colorshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Custom Presentation PlaqueChange the relief-carved elements for a personalized awardTruitt, Floyd L.42Spring200858-63PlaqueRelief CarvingHome Decorhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Stylish BirdhouseRelief-carved shingles and graceful designs adorn this essential songbird houseMckenzie, Barry42Spring200865-69Chip CarvingBirdhouseRelief Carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Kolrosing: Norwegian Line CarvingEasy-to-learn carving technique produces beautiful decorative designsRitger, Judy42Spring200870-73Line carvingKolrosingPlatehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Cut your own carving blanksSimple technique reduces the time you spend roughing out a carvingDuginske, Mark42Spring200874-75Band SawToolsShopmadehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
All About Files, Rasps & RifflersThese versatile tools have a wide range of carving usesSchroeder, Roger42Spring200878-80ToolsFilesRaspsRifflershttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Paintbrush BasicsGuidelines for getting the most from your brushesRhodes, Vicki42Spring200896Teacher's cornerPainting suppliesBrusheshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-42-spring-2008.html
Product ReviewWoodcarving with Chris Pye, Vol. 2: Letter Carving, Vol. 3: Ornamental Carving and Lee Valley Painters' PyramidsDuncan, Bob43Summer200814chris pyeletter carvingornamental carvinglee valleypainter's pyramidshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Relief ColumnCeltic CrossIrish, Lora S43Summer200816relief carvingcelticreligioushttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
CheckmateNovel chip-carved chess set is sure to become a family heirloomMckenzie, Barry43Summer200819-23Chip CarvingChessGameshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Strategy with a ThemeJim Arnold's clever chess set designsArnold, Jim43Summer200824-25ChessGamesPracticalhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Hobo NicklesModern carver recreate unique American folk artShamey, Bob43Summer200826-27NicklesHoboCoinsFolk arthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
First CutsArtists chronical thei journey from beginner to accomplished carver43Summer200829-31HennThorntonSchmitgenPricecaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Serpentine Walking StickStaff and realistic snake are carved from a single piece of woodStehly, David43Summer200831-37SnakeCanewalking stickRealistichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Rugged Bear BenchRustic carving highlights sturdy children's furnitureCooper, Jeffrey43Summer200838-45BearBenchKidshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Carving on TurningModern woodturning masters embellish their work with carving43Summer200846-49WoodturningCarved bowlsTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Color GuardSuggest form and flow with a basic relief carving honoring the armed forcesJack-Bleach, Mary Ann43Summer200850-55SoldierRelief CarvingPatriotichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Basic Relief TechniquesLearn the fundamentals of carving in low reliefPye, Chris43Summer200856-61RiverKanjiLettersreliefhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Paint PrimerEssential knowledge for a professional finishRhodes, Vicki43Summer200862-63PaintAcrylicTipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Goat of Many ColorsCharming folk-art design is easy to carveKoosed, Larry43Summer200864-69GoatFolk ArtCaricatureshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Woodland Treasures JewelryThe artistic carvings of Geoff KingRyan, Kathleen43Summer200870-71jewelryBog oakFasionhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Carving a Knotwork BroochKing, Geoff43Summer200872-73jewelryKnotworkPinhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Awakening a PassionThe work of professional Austrian carver Helli Mayr43Summer200874-75AustriaCarverProfessionalInternationalhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
5-Minute WizardBeginner Project is a quick and easy introduction to woodcarvingHindes, Tom43Summer200878-80WizardWhittlingBeginnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Electronic Saloon ClockDetailed caricature scene is brought to life with recorded voices and chiming gun shotsBoggio, Jack43Summer200882-83CaricaturesClockSceneSaloonhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Sharpening V-toolsHandy jig makes it easy to get a perfect edgeEnglish, John43Summer200894V-toolTeachers CornerJighttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-43-summer-2008.html
Product ReviewFlexcut SK120 scraper set and Henkel Consumer Adhesives PL Fix 2-part Wood Repair KitDuncan, Bob44Fall200814flexcutscraper sethenkel consumerwood repair kithttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Relief ColumnHarvest MaidenIrish, Lora S44Fall200816relief carvingfallscenichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Carving a New Life for Old FurnitureTraditional relief carving adds value to flea market findsZongker, Dennis44Fall200821-25ChairShellRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Chris Pye Named WCI Woodcarver of the YearBritish master carver honored for his contributions to artDuncan, Bob44Fall200826-29Woodcarver of the YearChris PyePyeChrishttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Align the Grain for Impressive CarvingsGrain direction strengthens and accents a carvingEllenwood, Everett44Fall200830-33GrainWoodTipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Creating a Deep-relief MantlePower carve individual panels for a full size mantelMifflin, Jerry44Fall200834-39MantelPower carvingLeaveshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Teaching Kids to CarveJim Calder's sweet potato faces make carving easyRyan, Kathleen44Fall200840-41Sweet potatoJim CalderTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Just Carve TrianglesJim Calder's simple method makes it easy to share the basics of carvingCalder, Jim44Fall200842-43TrianglesFacesBasicshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
First CutsArtists chronical thei journey from beginner to accomplished carver44Fall200844-47BooneWilliamsOrtelWolfehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Carving a Hillbilly Chess SetStage your own backwoods batle with patterns for a complete chess setCartledge, Mitchell44Fall200848-57HillbillyCaricaturesChesshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Carving in Low ReliefLearn to creat the illusion of a 3-D carving in thin woodPye, Chris44Fall200858-63Relief CarvingLow ReliefKoihttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Quilt Patterns Inspire Chip-carved CoastersClassic geometric designs embellish this useful caddyMckenzie, Barry44Fall200864-69Chip CarvingCoastersQuiltshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Quick-carve Halloween CatColorful pumpkins and whimsical cat make a great beginner's projectJoslyn, Cyndi44Fall200870-74HaloweenCatBeginnerPumpkinhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Carving a House SignLearn letter-carving and gilding techniques with a traditional plaqueLestingi, Francis44Fall200876-80SignLettersGildinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Showcasing Your WorkSimple methods to create a professional portfolioJack-Bleach, Mary Ann44Fall200882-83PortfolioPhotographyTipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Setting Up Your Painting AreaOrganize your finishing area for maximum efficiencyRhodes, Vicki44Fall200894Teacher's cornerPaintTipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-44-fall-2008.html
Product ReviewGuinevere Sanding SystemDuncan, Bob45Holiday200818King Arthur ToolsGuinevere Sanding Systemhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Relief ColumnSaint NicholasIrish, Lora S45Holiday200820relief carvingchristmasSantahttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
2008 WCI Santa Carving Contest45Holiday200823-30SantaContestWinnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Woodcarving that Gets NoticedTeam mascots on a large scale promote woodcarving and community prideBranson, Rex45Holiday200832-33MascotsLargeSportshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Preserving a Historic Art FormBob Johnson shares his passion for carving fish decoys with studentsJohnson, Christle45Holiday200834-35DecoyFishRealistichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Carved NativitiesExploring the tradition of Krippele Schaun in Tirol, AustriaEberling, KurtMayr, Helli45Holiday200836NativitiesAustriaReligioushttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Chip Carve a Star Tree TopperCarve through bleached wood to highlight chip cavitiesStrautman, Roger45Holiday200837-41Chip CarvingStarChristmashttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Happy Christmas GnomeEasy beginner character can be carved as Santa's helper or a garden gnomeOar, Ross45Holiday200842-43GnomeChristmasSantahttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
First CutsArtists chronical thei journey from beginner to accomplished carver45Holiday200844-47BattePrescottSchumacherHajnyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Whimsical Santa Holds your Christmas StockingDelightful folk-art styld carving is a functional addition to your holiday décorCipa, Shawn45Holiday200848-53SantaStocking holderFolkhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Power Carving a Dove OrnamentClassic symbol of peace makes a beautiful Christmas ornamentParks, Hugh45Holiday200854-57DoveOrnamentPower Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Carving in High ReliefProduce a dramatic effect by lowering the background and undercutting the subjectPye, Chris45Holiday200858-63FishHigh ReliefKoiReliefhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Santa Brings Home the Christmas TreeCharming details highlight this action poseAkers, Mark45Holiday200864-67SantaTreeCaricatureshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Carving Candy Cane OrnamentsPractice basic carving and painting skills with easy Christmas ornamentsBorders, Hershall45Holiday200868-73Candy CanesOrnamentsCanehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Carving a Snowman Collector's PlateLearn the basics of intaglio carving with this cheerful winter relief sceneBiermann, Robert45Holiday200874-77SnowmanIntaglioPlatehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Carving a Traditional LovespoonClassic heart design is a great project for novice carversWestern, David45Holiday200878-79HeartSpoonPracticalhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Gilding a House SignLearn gold-leafing techniques with a handcarved residential plaqueLestingi, Francis45Holiday200880-83SignLettersGildingGoldhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Preparing Your Carving for PaintChoose the right technique for a perfect finishRhodes, Vicki45Holiday200894Teacher's cornerPaintFinisheshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-45-holiday-2008.html
Santa EarringsTiny carved Santas let you wear your holiday cheerJensen, Rick451Hand Carved Holiday Gifts Vol. 1200822santajewelrychristmashttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Santa Collector's PlateIntaglio-relief techniques bring this Victorian Santa to lifeBiermann, Robert451Hand Carved Holiday Gifts Vol. 1200824platechristmasintagliorelief-carvehttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Power Carve a Miniature CardinalColorful little bird can be used as a pin or ornamentCalef, George451Hand Carved Holiday Gifts Vol. 1200829power carvingwildlifebirdcardinalhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Trivet Designs Make Great Holiday GiftsArchitectural designs highlight practical and beautiful carvingsWilbur, Frederick451Hand Carved Holiday Gifts Vol. 1200834trivetarchitectural designdécorhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Noah's Ark SantaSubtle colors add country charm to this classic Father ChristmasBrown, Steve451Hand Carved Holiday Gifts Vol. 1200840noah's arksantachristmasfolk arthttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Weight Watcher SantaHumorous carving shows Santa joining the fitness crazeSmith, Arnold451Hand Carved Holiday Gifts Vol. 1200843santaalternativechristmasweight watcherscaricaturehttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Power Carve a Folk-Art SantaNeutral colors and an antique finish give this Santa year-round appealPribyl, Ed451Hand Carved Holiday Gifts Vol. 1200846santafolk-artpower carvechristmashttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Special Delivery SantaCustomize this classic St. Nick by carving personalized toysStewart, Doug451Hand Carved Holiday Gifts Vol. 1200851santapersonalized toyscarvingchristmashttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Flat-plane SantaTree-bearing Santa makes a quick and easy giftShipley, Mike451Hand Carved Holiday Gifts Vol. 1200854flat-planesantachristmaseasyhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Carving a Santa in MotionSanta weathers a snowstorm to make a Christmas Eve deliveryZanzalari, John451Hand Carved Holiday Gifts Vol. 1200856santasnowstormmotionhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Carve a Santa EggheadStart with an ostrich-size basswood egg for a quick Christmas projectJensen, Rick451Hand Carved Holiday Gifts Vol. 1200860eggheadsantachristmashttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Carve a Christmas Candy Dishanta takes up woodcarving to maintain his jolly figure in this chocolate-inspired pieceMcGuire, Jim451Hand Carved Holiday Gifts Vol. 1200862christmascandy dishsantadécorhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Create a Playful Chris-Moose OrnamentJointed limbs and wire antlers give this holiday moose a rustic charmJoslyn, Cyndi451Hand Carved Holiday Gifts Vol. 1200866mooseornamentchristmasrustichttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Christmas PuppyAdorable stocking-stuffer pooch is designed to dress up your guest towelsSmith, Sandy451Hand Carved Holiday Gifts Vol. 1200870christmaspuppydécorhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Christmas Elf OrnamentsPierced-relief technique adds texture and dimension to the elf's beardGargac, Mark451Hand Carved Holiday Gifts Vol. 1200872ornamentselfchristmaspierced-reliefhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Chip Carve Delicate Icicle OrnamentsPierced designs allow you to adjust the size of the carving blank to suit your skill levelMcKenzie, Barry451Hand Carved Holiday Gifts Vol. 1200878ornamentsiciclechip carvepiercedhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Folk-art Santa OrnamentsSimple chip-carved and star designs add a nostalgic charm to your treeMaxwell, Jim and Margie451Hand Carved Holiday Gifts Vol. 1200880ornamentssantafok-artchristmashttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Chip-carved Honeycomb OrnamentsGeometric designs are inspired by hanging Victorian paper decorationsTudor, Linda451Hand Carved Holiday Gifts Vol. 1200884ornamentshoneycombgeometricvictorian-inspiredhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Christmas Cookie OrnamentRelief-carved Santa is inspired by tasty holiday treatsIrish, Lora S.451Hand Carved Holiday Gifts Vol. 1200886ornamentcookiesantachristmashttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Geometric Chip-Carved OrnamentsCreate elegant ornaments with traditional chip carving techniquesStrautman, Roger451Hand Carved Holiday Gifts Vol. 1200892ornamentchip-carvedgeometrichttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Relief Carve Santa OrnamentsSimple cuts and painted eyes make these ornaments ideal for beginnersJoslyn, Cyndi451Hand Carved Holiday Gifts Vol. 1200894relief-carvesantaornamentbeginnerhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Hangin' On Santa OrnamentClassic holiday design can function as an ornament or a decorative fan pullBrown, Steve451Hand Carved Holiday Gifts Vol. 1200896ornamentsantafan pulldécorhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Flat-plane Santa OrnamentTraditional Santa design can be carved and painted in an afternoonShipley, Mike451Hand Carved Holiday Gifts Vol. 1200898flat-planesantaornamentquickhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Carving Caricature Santa OrnamentsChange the beard and hat on this traditional Santa face for two distinct ornamentsRhadigan, Floyd451Hand Carved Holiday Gifts Vol. 12008100caricaturesantaornamentshttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Candy Cane Squirrel OrnamentTexturing of the squirrel's fur brings this adorable Christmas ornament to lifeHajny, Desiree451Hand Carved Holiday Gifts Vol. 12008104power carvinghand carvingwildlifesquirrelhttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Carving Ornaments from Scrap WoodTiny Santa can be carved with three toolsFeather, Jim451Hand Carved Holiday Gifts Vol. 12008112scrap woodsantaeasychristmashttps://www.foxchapelpublishing.com/hand-carved-holiday-gifts.html
Product ReviewNora Hall Carving DVDs, and Garrett Wade Patternmaker's ViseDuncan, Bob46Spring200916Nora Hall Designscarving dvdsGarrett Wadepatternmaker's visehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Relief ColumnSeaside PelicanIrish, Lora S46Spring200918relief carvingsummerwildlifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Overcoming AdversityDecoy Carver Karl Schmidt is a lesson in perserverenceVarner, Dr. Lawrence46Spring200920-21DecoysHandicappedparalyzedhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
An Introduciton to Carving With PowerSolomon, ChuckHamilton, Dave46Spring200923-25Power CarvingToolsTipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
First CutsArtists chronicle their journey from beginner to accomplished carver46Spring200926-27Falin, GaryRaine, DougArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Hate to Sharpen? Disposable Blade Carving Tools may be the AnswerInexpensive tools are great for detail work and small carvingsDuncan, Bob46Spring200928-30XactoExcalWarrenToolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Carving a TrollDisposable blades and doll hair make this project ideal for beginnersHolley, Marna46Spring200931-35TrollsHand carvingDoll hairXactohttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Painted TurtleColorful reptile project provides an opportunity to experiment with contrasting texturesStiller, GordonStiller, Marsha46Spring200936-37TurtlePattern ProfilesStillershttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Build Your Own Carving StandMake your own custom version of a $500 stand for only $50Farley, Jim46Spring200938-45StandVisesclamphttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Carving a Musical FrogQuick and easy project is a fun musical instrumentEllenwood, Everett46Spring200946-48FrogsInstrumentMusichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Releasing a Wood SpiritUncover the character hiding in found woodGargac, Mark46Spring200949-55Wood SpiritsCottonwood barkBarkhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Anatomy of WoodImprove your carving efficiency with an understanding of wood grainEllenwood, Everett46Spring200956-59WoodGrainStrengthhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Carving Custom Light-switch CoversAdd character t your home with relief- and chip-carved accentsMayfield, Ben46Spring200960-63Light-switch coversChip CarvingRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Peek-A-Boo JayDelightful critter splitter carving is sure to get a second lookBrooks, Doug46Spring200964-69Blue JaySplitCritter splitterhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Carving a Pierced ReliefOpen spaces add movement and drama to a relief carvingPye, Chris46Spring200970-75KoiFishRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Adding Subtle ColorRoughing and drybrushing techniques add life to your carving without overpowering the woodIrish, Lora S46Spring200976-79PaintingWoodspiritTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Creating Handcarved MagnetsFunctional floral decorations are a lesson in traditional carving techniquesWilbur, Frederick46Spring200981-85MagnetsFlowersArchitecturalhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
All About PunchesAdd texture and designs to your carving with these simple toolsSchroeder, Roger46Spring200986TipsTextureTechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-46-spring-2009.html
Product ReviewKoch Sharpening System and Lee Valley Veritas Cane and Staff TipDuncan, Bob47Summer200916Koch Sharpening Systembuffing compoundLee ValleyVeritas Cane and staff tiphttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Relief ColumnRustic Barn SceneIrish, Lora S47Summer200918relief carvingbarnscenichttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Best of ShowAward-winning carvings from across the country47Summer200920-23ContestCommunityWinnershttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Sharing the Joy of Carving WoodBuild self confidence and provide a life-long hobby by teaching kids to carveBrock, Dave47Summer200924-29KidsTeachingTipshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
First CutsLearning from Others; From Whittling to Architectural Wonders47Summer200930-31GargacWilburArtist Profilehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Making a Tramp Art FrameEasy chip cuts and simple joints make this frame an ideal project for novice carversSeabring, Jim47Summer200932-35Tramp artFrameHome Decorhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Exploring the Culture of Maori WoodcarvingNew Zealand natives use woodcarving to document their history and honor their ancestorsDavis, Mike47Summer200936-41MaoriSpiralNew Zealandhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
How to Select the Right Power Carving EquipmentAn overview of the types of tools and different modelsSolomon, CharlesHamilton, David47Summer200942-47Power CarvingToolsTipshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Hand Carve a Realistic WolfWoodburn detailed fur texture on this classic predatorGipson, Dee47Summer200948-54WolfWoodburningFurhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Carving Realistic Wrinkles and FoldsCreate accurate details by studying how clothing relates to anatomyJack-Bleach, Mary AnnZavadil, Fred47Summer200955-59FoldsWrinklesAnatomyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Power Carve and Eagle PinMiniature project hones your carving and burning techniqueGroncki, Ed47Summer200960-63EaglePower carvingMinihttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Create an Nostalgic WhirligigSimple carved features, spinning arms, and a rustic finish make this project a winnerDePauw, Vernon47Summer200964-69WhirligigRusticFolkhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Creating a Simple ArmatureDesign your own carvings with the aid of armatures and clay modelsKaisersatt, Marv47Summer200970-71ArmatureClay modelTechniquehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Carving a Wren in the RoundWork with the grain and supporting wood to add strength to fragile areasPye, Chris47Summer200972-77WrenBirdsRealistichttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Making a Gargoyle CaneConstruction techniques for carving a functional caneCipa, Shawn47Summer200978-80CaneWalking StickGargoylehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Carving a Watchful DragonThis fun shelf sitter is the perfect guardian for your bookshelfRhadigan, Floyd47Summer200983-86DragonFantasyShelf-sitterhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-47-summer-2009.html
Product ReviewDremel Multi-Max and My Chip Carving's Flat Lying Trammel SetDuncan, Bob48Fall200916dremelmulti-maxmy chip carvingflat lying trammel sethttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Relief ColumnTranquil Goose SceneIrish, Lora S48Fall200918GooseWildfowlRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
John Burke: 2009 Woodcarving Illustrated Woodcarver of the yearPopular author and instructor honored for his contributions to woodcarvingDuncan, Bob48Fall200920-23BurkeWinnerArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
A Carved Tribute to the Edmund FitzgeraldPatrick Pointer's detailed relief carvings immortalize this famous Great Lakes freighter48Fall200924-27Edmund FitzgeraldPointerRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Making Colorful Leaf TilesEasy relief carvings have a variety of usesJoslyn, Cyndi48Fall200929-33LeafBowlCoasterhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
First CutsInspired to learn, carving out of necessity48Fall200934-35CipaJensenArtist Profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Whittling a 5-Minute OwlEasy beginner project is ideal for teaching and demonstratingOegema, Jan48Fall200936-38OwlBeginners5-minutehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Carving a Cherry Leaf BowlShowcase wood's natural beauty with this simple and functional designBailey, Brian48Fall200939-45CherryBowlScrapershttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Making an Elegant Book StandHand carve this ingenious folding stand from a single piece of woodLeenhouts, Marty48Fall200946-51Book holderChip CarvingReadinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Hand Carve a Majestic BuckCapture the graceful beauty of a whitetail deer in woodHajny, Desiree48Fall200952-59BuckDeerHandcarvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Carve a Gift-bearing SantaEasy-to-carve holiday icon is a clever way to present a cash giftDearolf, Don48Fall200960-64SantaCashGift-bearinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Carving a Caricature ColtSimple stylized horse is easy to carveRhadigan, Floyd48Fall200965-71HorseStylizedcolthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Carving a Flying WitchCreate your own humorous Halloween displayStetson, DaveStetson, Michele48Fall200972-79WitchCaricaturesPainting Techniqueshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Choosing Power Carving BitsMake smart purchases with a basic understanding of the cutters availableSolomon, CharlesHamilton, David48Fall200980-85BitsBurrsPower Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
OspreyStiller, GordonStiller, Marsha48Fall200986BirdWildlifeScenichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-48-fall-2009.html
Drilling Clean HolesEasily store back issues in a three-ring binder with the aid of this simple jigDuncan, Bob49Holiday20097JigHolesShophttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Product ReviewRazertip feather formersCorbett, Lori49Holiday200914Razertip woodburnerfeather formers penswoodburningbirdshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Relief ColumnChristmas Presents (Lamb and Puppy)Irish, Lora S49Holiday200916relief carvingchristmaswildlifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Creating Clothespin CarvingsClever idea turns ordinary clothespins into festive Christmas ornamentsHolder, Forrest49Holiday200918ClothespinsOrnamentsSantahttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Carving an 1880s Western TrainMembers of the Caricature Carvers of America join forces to creat a nostalgic display49Holiday200920-23CaricaturesTrainCowboyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Carve and Paint an Evergreen TreeComplement your Christmas carvings with elegant handcarved treesMason, Bob49Holiday200925-29TreeEvergreenChristmashttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Secret Treasures Santa ClausSanta's chimney doubles as a hidden boxCall, Deborah L.49Holiday200930-32SantaBoxKeepsakehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Hand Carving a Simple ReindeerEasy-to-carve deer is the perfect compliment to your holiday displaySwartz, Don49Holiday200933-39ReindeerDeerBeginnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Carving a Star OrnamentCreate colorful holiday ornaments with basic techniquesSebring, Jim49Holiday200940-42StarOrnamentFolkhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Heirloom Santa OrnamentHand carve tis festive design modeled after vintage glass ornamentsShinlever, Wayne49Holiday200943-47SantaOrnamentChristmashttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Carve a Christmas StockingDelightful project adds country charm to your holiday décorPye, Chris49Holiday200948-52StockingMouseChristmashttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Whittling Santa PencilsTurn ordinary pencils into festive Santas in eight easy stepsJohnson, Ron49Holiday200953-55SantaPencilChristmashttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Carving Farmyard AnimalsCreate ornaments or freestanding toys from these simple designsBertils, IreneDussinger, Dusty49Holiday200956-59CowDuckGeesePighttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Power Carve a Wooden SpoonFunctional project introduces basic power carving techniquesHamilton, DaveSolomon, Chuck49Holiday200960-63Power CarvingSpoonBeginnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Passing Preflight InspectionLearn texturing secrets and get a behind-the-scenes look at the planning processSmith, Sandy49Holiday200964-69SantaRudolphTextureshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Easy Santa OrnamentQuickly build your holiday inventory with eye stamps and a simple templateHaack, Dan49Holiday200970-72SantaTemplateStamphttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Relief Carve a Winter LighthouseCapture the tranquility of a snow-covered landscape with this painted relief sceneStadtlander, Robert49Holiday200973-79LighthouseReliefSeasidehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Build a Carver's LapboardCarve in your living room with this simple shop-made boardMacKay, Gary49Holiday200980-81Chip carvingLapboardShopmadehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Making Heirloom RattlesClassic carving projects make thoughtful giftsHochhalter, Gene49Holiday200982-84ball-in-cageRattlesBabyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-49-holiday-2009.html
Product ReviewForedom K.1020 Micro GrinderDuncan, Bob50Spring201012ForedomMicro GrinderProduct Review
Carving Stories in ReliefEvengy Krayushkin expresses his artistic vision in woodDuncan, Bob50Spring201016-19Relief carvingPaintArtist Profile
Whittler on a MissionRick Weibe shares his passion for woodcarving with the next generationRyan, Kathleen50Spring201020-22WhittlingKidsArtist Profile
Sharpening a PocketknifeWeibe, Rick50Spring201023SharpeningPocketknifeTools
Whittle a Flying PropellerQuick and easy project is perfect for beginnersWeibe, Rick50Spring201024-25PropellerWhittlingBeginner
First CutsPye, ChrisShipley, Mike50Spring201026-27PyeShipleyFirst Carvings
Sharpening EquipmentAn overview of the major sharpening systems for woodcarvers50Spring201028-32SharpeningToolsProduct Review
Sharpening a Carving KnifeQuick and easy steps to keep your knife ready to carveProffitt, Mac50Spring201033-35KnifeSharpeningProduct Review
Creating a Milkweed PodBring a carving to life with realistic habitatVan Horn, Don50Spring201037-42GoldfinchMilkweed PodHabitat
Creating Custom Greeting CardsQuick and easy carvings add a special touch to handmade cardsLivingston, Edmund Jr.50Spring201043-45CardBearWhittling
Carving a Green ManCelebrate spring with a fresh approach to a traditional designPye, Chris50Spring201046-52Green ManPaintTechnique
Power Carving in ReliefSimple pintail duck is a great introduction to reciprocating toolsSolomon, CharlesHamilton, David50Spring201053-57Pintail DuckReliefPower Carved
Building a Tilting Carving TableCustomize this shop-made bench to maximize comfort and efficiencyFarley, Jim50Spring201058-61BenchCarving tableShopmade
Making Silly SheepGolf-tee legs make this caricature critter easy to carveWorley, Don50Spring201062-65SheepCaricatureGolf Tees
Guarding the TreasureSharpen your skills at creating expressions with this fun caricature pirateFarr, Jim50Spring201066-69PirateCaricatureIntermediate
Carving Word WhimseysConnect letters with carved links to create unique name plaquesQuarve, Roy50Spring201070-73WordWhimseysBeginner
The Rule of ThreeCreate accurate proportions in your figure carvingsMertz, Donald K.50Spring201074-77Figure CarvingProportionHobo
Carving a Realistic EyeNine simple steps for consistant resultsHull, Joel50Spring201078-79EyesRealisticTechnique
Relief Carve a Magical Fairy DoorQuick and easy project comes alive with vivid colorsWhite, Christina50Spring201081-84FairyDoorsWhimsical
Relief ColumnVictorian PortraitIrish, Lora S51Summer201014relief carvingportraitvictorianhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Best of ShowAward-winning carvings from the nation's top woodcarving showsDuncan, Bob51Summer201018-21DavenportContestWinnerhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Andy Anderson's Custom Carved FurnitureA unique look at the grandfather of caricature carving's lesser known workVolpp, Paul51Summer201022-25AndersonFurnitureGalleryhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Handcarving a Baby SpoonQuick and easy project makes a useful giftJohnson, Carl51Summer201026-28SpoonBabyPracticalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Whittling Whimsical BookmarksPlayful figures make quick and easy giftsLund, Jack51Summer201029-31Bookmarkcaricaturestylizedhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Carving a Caricature PigCharming project makes an ideal beginner projectCoffman, Christine51Summer201032-35PigCaricatureBeginnerhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Turning Branches into Spice ShakersRustic salt and pepper holders add personality to your table or picnic basketLubkemann, Chris51Summer201036-37ShakersStickBranchhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Make a Moving Magnetic CarvingClever use of magnets is a fun conversation starterWolterstorff, Larry51Summer201038-41MagnetsCaricaturemovinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Power Carving a Polar BearDevelop your skills with this easy stylized projectSolomon, CharlesHamilton, David51Summer201042-47Bearpower carvingstylizedhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Carving an Army PrivateAttention to detail brings this caricature of an enlisted man to lifeSmith, Arnold51Summer201048-55PrivateCaricatureArmyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Sculpting Elegant Horse Head BookendsStylized carvings are modeled after classic T'ang Dynasty HorsesPye, Chris51Summer201056-63HorseChineseBookendshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Carve a Stylized TroutUse power tools to create a beautiful carved fishDean, Tom51Summer201064-69FishStylizedPower Carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Relief Carve an Old World SaintCreate the look of flowing fabric with classic techniquesHall, Nora51Summer201070-73SaintFabriclinenhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Sanding TechniquesDecrease sanding time with shop-tested tipsBurton, Mike51Summer201074-75SandingTipsShophttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Creating Seashell DecorationsEasy techniques unveil the beauty of natureBuyer, Robert L.51Summer201076-78SeashellsBeginnersTechniquehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Building a Carving ArmShop-made holding device promotes safe carving techniquesSidler, LaVerne ''Sid''51Summer201080-82ShopmadeArmToolshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
Sharpening ChiselsCreate and maintain a sharp edge on chisels and skew chiselsProffitt, Mac51Summer201084ChiselsSkew chiselsSharpeninghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-51-summer-2010.html
The Whittling Whimsy of Walt GarrisonRetired pro-football player loves to carveRyan, Kathleen52Fall201016-17WhittlingGarrisonWaltFootballhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
2010 Woodcarver of The Year: Tom WolfeRecord-holding author honored for his impact on woodcarvingDuncan, Bob52Fall201026-29WolfeTomWoodcarver of the Yearhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Carving a Pierced Relief TreeTexturing and back cutting add dimension to this shallow relief projectStephenson, MaAnna52Fall201030-34treepierced reliefback cuttinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Embellishing with Basswood InlaysUse a router to insert a soft inlay into hardwood for easier carvingStewart, David52Fall201036-39Chip CarvingInlayRouterhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Making a Carved Jack-O'-LanternLight up this fun Halloween project with battery-operated tea lightsSmith, Sandy52Fall201040-43PumpkinlightsJack-o'-lanternhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Carving an Oak Leaf BowlRelief carved leaves create an elegant borderPye, Chris52Fall201044-48bowloakleaveshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Carving a Private InvestigatorLaminate on additional wood to accommodate the detailsThornton, Dennis52Fall201049-51private investigatorlaminatecaricatureshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Carving a Woodspirit in Cottonwood BarkBring this mythical being to life with well-proportioned facial featuresOtto, Edward52Fall201052-57woodspiritWood Spiritcottonwood barkhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Power Carve a Canvasback DuckLearn the basics of texturing feathers with this half-size decoySolomon, CharlesHamilton, David52Fall201058-65duckCanvasbackPower Carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Handcarving a Realistic SquirrelWoodburned details and dry brushing bring this cute critter to lifeGoddard, Leah52Fall201066-72squirrelwoodburningrealistichttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Relief Carve an Autumn SceneUse acrylic paints to add color to this charming designBiermann, Robert52Fall201074-76autumnRelief Carvingreliefacrylic paintshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Making Maple Leaf PinsQuick and easy project is easy for beginnersHoesman, John52Fall201078-80leafmaplepower carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Sawing Carving BlanksSpeed up the roughing-out process by cutting three views with your band sawWillis, Jim52Fall201082-83band sawblanksroughing outhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Miniature scarecrow ornamentQuick and easy carving adds a whimsical touch to fall décorSmith, Gerald52Fall201084scarecrowornamentautumnhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Shelf Sitter ElfFantasy caricature hangs out on a ledgeRhadigan, Floyd52Fall201087-93elfcaricaturefantasyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-52-fall-2010.html
Relief ColumnAngel of PeaceIrish, Lora S53Holiday201012relief carvingangelreligioushttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
2010 Woodcarving Illustrated Best Carving Design Contest53Holiday201015-22Design contestcontestwinnershttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Earning the Woodcarving Merit BadgeWoodcarvers help Boy Scouts earn merit badges at the National JamboreeRies, Paul53Holiday201024Boy ScoutsMerit BadgeNational Jamboreehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Coming Full Circle: Chris Hammack's StoryCaricature carver explores the giftware industry before returning to his woodcarving rootsVigil, Corri53Holiday201026-28HammackChriscaricaturesgiftwarehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Cowboy Bottle StopperBold cuts are the secret to a handcarved rustic lookHammack, Chris53Holiday201029-31Cowboybottlestopperhammackhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Carving a 15-Minute SantaQuick and easy ornament makes a fun holiday giftHindes, Tom53Holiday201032-34Santa15-minutequickeasyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Whimsical Santa TreesFun and festive carving adds holiday cheerMacDougall, William53Holiday201036-40Santatreecaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Painting a Canvasback DuckLearn the basics of painting a realistic duckSolomon, CharlesHamilton, David53Holiday201042-45paintingduckcanvasbackhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
From Scissors to SantasDave Francis follows his passion for Santa CarvingDuncan, Bob53Holiday201046-48SantaFrancisHairdresserhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Braided Beard SantaTexture and depth make Santa's beard a fun focal pointFrancis, Dave53Holiday201049-51SantaHairTextureshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Creating a Gothic Mirror SconceTraditional design combines woodworking, woodcarving, and gilding techniquesPye, Chris53Holiday201052-59mirrorsconcegildinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Carving an Arizona Stick SantaCarve one of these quick and easy Santas for everyone on your Christmas listStetson, Dave53Holiday201060-63Santastickquickeasyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Relief-Carved Santa OrnamentsLightweight carvings are designed to add joy to your Christmas treeHendrix, Susan53Holiday201064-68Santarelief carvingornamenthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Quick-Carve Stackable SnowmanThis fun holiday gift features interchangable partsFreaner, Claude53Holiday201069-71SnowmanHolidayChristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Making a Traditional Santa OrnamentEasily adjust the size of the carving using basic proportionsHarrell, Millard53Holiday201072-77SantaOrnamentProportionshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Making Carvings from Scroll Saw PatternsSimple modifications open up a whole new source for carving patternsAndreychek, Dave53Holiday201079-81Scroll SawPatternsOrnamentsIntarsiaFretworkhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Simple Hedgehog OrnamentCharming folk-art design is easy to carve and finishDuncan, Bob53Holiday201082HedgehogFolk ArtOrnamenthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
Sharpening A GougeSimple technique produces a sharp cutting edgeProffitt, Mac53Holiday201084gougesharpeningtoolshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-53-holiday-2010.html
All About ToolsKochan, Jack531Power Carving Tools & Techniques20109ShopToolsProduct Reviewhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Power Carving SafetyRussell, FrankSolomon, ChuckHamilton, Dave531Power Carving Tools & Techniques201010/11/2014safetypower carvingtoolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Be A Pro: Safety TipsKochan, Jack531Power Carving Tools & Techniques201012Safetypower carvingtoolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
How to Select the Right Power Carving EquipmentHamilton, DaveRussell, FrankSolomon, Chuck531Power Carving Tools & Techniques201013-65Power CarvingToolsSafetyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Flexible Shaft Machine Maintenance531Power Carving Tools & Techniques201023-31Flexible Shaft MachinesForedomMaintenancehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Micro Motor Machine Maintenance531Power Carving Tools & Techniques201041-44Product ReviewMaintenancetoolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Air Turbine Maintenance531Power Carving Tools & Techniques201047-48Air turbineMaintenanceProduct Reviewhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Woodburner Tip Maintenance531Power Carving Tools & Techniques201059WoodburnerTipsMaintenancehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Choosing Power Carving BitsSolomon, ChuckHamilton, Dave531Power Carving Tools & Techniques201067-72Power CarvingBitsToolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Cleaning and Maintaining BitsRussell, Frank531Power Carving Tools & Techniques201073-76MaintainingPower carvingBitshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Understanding Power Carving TechniquesKochan, Jack531Power Carving Tools & Techniques201078Power CarvingTechniquesToolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Power Carving BitsKochan, Jack531Power Carving Tools & Techniques201079-81Power CarvingBitsProduct Reviewhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Texturing a Miniature Mountain BluebirdCorbett, Lori531Power Carving Tools & Techniques201082-84bluebirdtexturingsongbirdhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Woodburning HairKochan, Jack531Power Carving Tools & Techniques201086-87woodburninghairtexturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Power texturing Fur and HairRussell, Frank531Power Carving Tools & Techniques201088-92power carvinghairtexturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Using Reciprocating Carvers in Place of Hand ToolsBennett, David531Power Carving Tools & Techniques201094-95reciprocating carverspower carvingToolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Power Carve a Wooden SpoonSolomon, ChuckHamilton, Dave531Power Carving Tools & Techniques201098-101spoonpower carvingtipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Power Carving a Heart PendantCarve a beautiful necklace using basic power carving techniquesMcCaffrey, Keoma531Power Carving Tools & Techniques2010102-105necklacepower carvinghearthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Power Carving a Classic House SignUse a reciprocating carver and gold leaf to create this stunning projectBennett, David531Power Carving Tools & Techniques2010107-112signpower carvingreciprocating carverlettershttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Gunstock CarvingUse an air turbine machine to carve a gunstockJanny, Bill531Power Carving Tools & Techniques2010115-118gunstockair turbinepower carvingdeertreeshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/power-carving-tools-techniques-wci-2010.html
Handcarved Santa GalleryArtist Deborah Call offers advice on selling your work through galleriesDuncan, Bob532Hand Carved Holiday Gifts Vol. 220106/7/2014selling carvingsSantastipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Saint Nicholas Lights the WayCharming Santa scene has an Old World feelCall, Deborah L.532Hand Carved Holiday Gifts Vol. 220108/11/2014St. NicholasSantascenichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Sleigh Bell SantaWoodburned details complete this fun holiday carvingFrancis, Dave532Hand Carved Holiday Gifts Vol. 2201013-15SantaWoodburningholidayhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Carving a Fusion SantaCombine caricature carving with chip carving for a unique projectPeiffer, Gary M.532Hand Carved Holiday Gifts Vol. 2201018-23SantaCaricatureChip Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Celestial SantaSanta takes a nap nestled in a crescent moonRhadigan, Floyd532Hand Carved Holiday Gifts Vol. 2201025-27SantaMoonCaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Chip Carve Pinecone OrnamentsSimple repetitive cuts create a quick and easy holiday projectHiser, Jim532Hand Carved Holiday Gifts Vol. 2201029-31pineconechip carvingornamenthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Candy Cane Santa OrnamentFestive swirled hat design is fun to carveFrancis, Dave532Hand Carved Holiday Gifts Vol. 2201032-37Santaswirlhatornamenthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Making Santa OrnamentsQuickly build inventory for craft shows and gift givingStetson, DaveStetson, Michele532Hand Carved Holiday Gifts Vol. 2201038-39SantaOrnamentGiftshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Carving a Hanging Santa OrnamentFull-figure Santa dangles from a one-handed gripCoffman, Christine532Hand Carved Holiday Gifts Vol. 2201040-43SantaOrnamentGiftshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Heirloom Santa OrnamentTraditional design is carved in relief for a lightweight ornamentHendrix, Susan532Hand Carved Holiday Gifts Vol. 2201044-45SantaOrnamentRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Mother and Child OrnamentRelief portrait of Mary and the baby Jesus celebrates the real reason for the seasonCipa, Shawn532Hand Carved Holiday Gifts Vol. 2201046-47JesusMaryOrnamenthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Relief-carved Santa OrnamentLightweight ornament is the perfect compliment to your Christmas treeBiermann, Robert532Hand Carved Holiday Gifts Vol. 2201048-49SantaOrnamentRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Creating Toy Block OrnamentsPersonalized ornaments make perfect keepsakesSavarese, Joseph532Hand Carved Holiday Gifts Vol. 2201050-53blocksornamentlettershttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Handcarving a Traditional Santa OrnamentUse these techniques to create ornaments in a variety of sizesLunsford, Blake532Hand Carved Holiday Gifts Vol. 2201054-58SantaOrnametcaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Carving and Painting SnowmenCreate these charming characters as figures or ornamentsWatts, Leonard532Hand Carved Holiday Gifts Vol. 2201059-61SnowmenOrnamentsFigureshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Chip Carving a Candle PlateElegant design comes to life with simple knife cutsBarton, Wayne532Hand Carved Holiday Gifts Vol. 2201062-66Chip CarvingCandlePlatehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Simple Santa SpoonCreate this novel carving from inexpensive wooden spoonsBeane, Roger532Hand Carved Holiday Gifts Vol. 2201067SantaSpoonPracticalhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Carving a Stylized Chickadee PinFlowing lines and a simple finish make this little bird easy to completeJensen, Rick532Hand Carved Holiday Gifts Vol. 2201068-71ChickadeePinBirdhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Making an Elegant Wooden BoxCombine woodworking and carving techniques to produce an exceptional handmade boxZongker, Dennis532Hand Carved Holiday Gifts Vol. 2201072-79boxroseRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Carving a Cottonwood Bark AngelUse a combination of hand and power tools to create this graceful stylized designMelom, Jack532Hand Carved Holiday Gifts Vol. 2201080-85AngelStylizedPower CarvingHand Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Polar Bear PatternUse this bear pattern to create a realistic or stylized carvingStiller, GordonStiller, Marsha532Hand Carved Holiday Gifts Vol. 2201086-87Polar BearBearCaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Top Hat SnowmanEasy broom add-on adds character to this winter iconRhadigan, Floyd532Hand Carved Holiday Gifts Vol. 2201090-92SnowmanAdd-onCaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Carving a Poinsettia EggEasy chip carving techniques create vibrant holiday accentsTudor, Linda532Hand Carved Holiday Gifts Vol. 2201094-96PoinsettiaEggRelief Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Making a Coffee ScoopSimple chip carved design highlights this functional spoonCadoret, Deanna532Hand Carved Holiday Gifts Vol. 22010100-102coffeescoopmeasuringcuphttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Creating Custom Frames with Carved AccentsRustic frames can be built to any size and embellished with fanciful carvingsHindes, Tom532Hand Carved Holiday Gifts Vol. 22010104-105GnomeframecarvingRustichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Making a Wine Bottle HolderEmbellish this useful design with Celtic knotworkCruze, Wayne532Hand Carved Holiday Gifts Vol. 22010108-110wine bottle holderknotworkceltichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Power Carving Walnut Shell BasketsMake whimsical little baskets in five minutes flatMcCaffrey, Keoma532Hand Carved Holiday Gifts Vol. 22010112walnut shellspower carvingbasketshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/handcarved-holiday-gifts-vol-2.html
Relief ColumnCivil War CapsIrish, Lora S54Spring201112relief carvingcivil warprojecthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
A Traditional MasterRussian Woodcarver Vladimir Rusinov draws on his heritage to create masterpieces in woodRyan, Kathleen54Spring201116-18RussianMasterCarverhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Bobbing Woodpecker Toothpick DispenserNostalgic mechanism is a fun and functional projectFenton, Gary54Spring201120-22woodpeckerToothpickholderdispenserhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Carving a Scandinavian-Style Troll QueenClassic flat-plane design is a great beginner projectRefsal, Harley54Spring201125-31trollqueenflatplanehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Carving and Painting a Birdhouse Napkin HolderLearn blending and shading techniques with this functional relief projectPadden, Betty54Spring201132-40reliefbirdhousebirdspaintinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Super Simple Fish from 2 x 4sEasy finishing technique highlights the grain in ordinary construction lumberTriplett, Robert54Spring201141-43fish2 x 4sstainhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Sculpting a Stylized OtterTransform found wood into a graceful carving that tells a storyMisenheimer, Sumner54Spring201144-53otterstylizedfound woodhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Cute Caricature ChipmunkWoodburn the fur to add detail to this quick and easy carvingKeller, Doug54Spring201154-59chipmunkcaricaturewoodburninghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Building a Portable Carving BenchSturdy shopmade bench folds flat for travel and storageSidler, LaVerne Sid54Spring201160-63foldingbenchcarvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Ribbon and Flowers FrameThis romantic frame makes a meaningful gift for a loved oneDavies, Mike54Spring201164-69frameflowersribbonhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Carving a Native AmericanUse basic techniques to carve distinct facial featuresEnlow, Harold54Spring201170-75native americanenlowbuststudy stickhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Making Custom Knife HandlesInexpensive, easy-to-make knives are so comfortable to use, you'll want to make more than oneJohnson, Carl54Spring201176-78cutomknifehandleshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Creating a Musical MouseCustomize this playful design for the musician in your lifeBrooks, Doug54Spring201181-85fiddlemousecaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Sharpening a V-toolEasy steps to tune a complex toolProffitt, Mac54Spring201186V-toolsharpeningtipshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-54-spring-2011.html
Relief ColumnFolk Art EaglesIrish, Lora S55Summer201114relief carvingpatrioticfolk arthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Great Horned OwlCarve a majestic bird of prey with this detailed patternStiller, GordonStiller, Marsha55Summer201118owlgreathornedpatternbirdhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Pat Scott Scores BigFormer baseball player now carves with Hall-of-Fame Right HandRyan, Kathleen55Summer201120-22baseballplayersportshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Dealing with Tree-Killing InsectsProtect local forests by preventing the spread of invasive insectsSmith, Dr. Stephanie55Summer201124-25emerald ash borerinsectsweevilsbeetleshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Carvers Unite to Honor VeteransInjured veterans are presented with handcarved eagle canesRyan, Kathleen55Summer201126-27canesveteranswarhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Best of ShowImpressive projects inspire woodcarvers everywhereDuncan, Bob55Summer201128-31best of showcarvingcontesthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Carving a Rabbit in Cottonwood BarkNatural wood makes a unique background for this realistic animalHajny, Desiree55Summer201132-38rabbitcottonwood barkfound woodhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Making Patriotic PinsSuper-simple project is easy to customizeWillis, Jim55Summer201139-41pinsflagheartcrosshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Carving a Folk-Art ChickadeeMake this attractive little bird from scrap woodTriplett, Robert55Summer201142-47chickadeefolk artbeginnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Carving EyesDefine any style eye with four simple V-cutsEnlow, Harold55Summer201148-50eyeenlowstudy stickhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Recipe ChefColorful caricature is happy to help out around the kitchenRhadigan, Floyd55Summer201151-53chefrecipe holdercaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Chip Carved Picture FrameEmbellish this basic frame with carved accentsMacKay, Gary55Summer201154-56chipcarvedFramehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Carve a Tower of Teetering TurtlesUse a woodburner to detail the shells of this haphazard pile of reptilesLimings, Harry L. Jr.55Summer201157-59turtletowerwoodburninghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Making a Mechanical Bottle StopperFun-loving character raises a glass with the clever use of dowels and cordsFreaner, Claude55Summer201160-67bottlestoppermechanicalcaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Roly-Poly HedgehogPower carve this cute critter from a basswood eggDalton, Keith55Summer201168-71egghedgehogpower carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Using a Contour GaugeClassic furniture-building tool makes it easy to create symmetry in your carvingsHitchens, William55Summer201172-73contour gaugesymmetryProduct Reviewhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Carving Tree Spirits in Found WoodAlter the Design based on the wood's characteristics for a unique carvingHoward, Keith55Summer201174-80tree spiritwood spiritfound woodhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Making Controlled CutsUse a two-handed grip to carve efficiently and accuratelyIrish, Lora S55Summer201182-85griptoolholdinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Maintaining a Sharp EdgeStrop your tools to keep them in top shapeProffitt, Mac55Summer201186stroppolishhonetoolshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-55-summer-2011.html
Product ReviewChris Pye's Woodcarving Workshops, and K&M Finishing TurntableDuncan, Bob56Fall201114Chris Pyeonline videosK&Mfinishing turntablehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Relief ColumnAutumn LeavesIrish, Lora S56Fall201116relief carvingfallprojecthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Comparing Carving GlovesAn overview of commonly available protective glovesDuncan, Bob56Fall201121-23glovesprotectionsafetyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Formula For SuccessGary Tatman carves precision-detailed scale replicas of legendary carsKinsey, Mindy56Fall201124-26carsmodelstatmanreplicahttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Miniature MasterpiecesBorn deaf, Pradeep Kumar expresses himself with artRyan, Kathleen56Fall201132-33deafmatchesIndiahttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
2011 Woodcarver of the Year: Vic HoodAward-winning carver is dedicated to sharing his talents with othersDuncan, Bob56Fall201134-37hoodvicWoodcarver of the Yearhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Cute Shelf-Sitter CatsFolk-art felines make charming pins or decorationsCipa, Shawn56Fall201138-39catsarkshelfsitterhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Carving a GnomeUse basic hand tools to carve a whimsical gnomeSmith, Gerald56Fall201140-44gnomehandcarvingpaintinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Carving Faces in SoftballsPolyurethane core is easy to carve and holds detail wellBrasher, Terry56Fall201145-51softballsfacetechniquehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Carving an American IndianNatural cottonwood bark is an ideal canvas for this icon of the old westAdamson, Ron56Fall201152-55indianbarkcottonwoodhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Making a Chip Carved Welcome SignHighlight the designs with a quick and easy coloring techniqueNicholas, Bruce56Fall201156-61signchip carvingcrayonhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Making a Cowboy Bottle StopperSimplify this realistic bust by carving the hat separatelyGargac, Mark56Fall201162-69cowboybottlestopperhathttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Carving a Bathtub BuddyUse decoy-carving techniques to make a child-size duckGiannetto, Vincent IIIGiannetto, David56Fall201170-73decoyduckbathtubhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Carving a WitchPractice exaggerating facial features with this fun Halloween caricatureEnlow, Harold56Fall201174-79witchenlowcaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Super Simple Santa OrnamentFaces are quick and easy when you hide the eyesWorley, Don56Fall201180-83SantaeyesCaricatureornamenthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Carving Thumbnail AccentsUse the tool's shape to create consistent repetative designsPye, Chris56Fall201184-89thumbnailstechniquesbreadboardhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Create a Poseable RobotBring this carved science-fiction figure to live with woodburned detailsPrater, Dennis56Fall201191-94robotposeablewoodburnedhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-56-fall-2011.html
Product ReviewTilt-Top Portable Bench, and Orbital Holding SystemCipa, Shawn57Holiday201114RP Myerstilt-top portable benchorbital holding systemgrip-all jawshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Relief ColumnChristmas GeeseIrish, Lora S57Holiday201116relief carvingchristmaswildlifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Usings Compases, Calipers, and DividersTransfer measurements and maintain proportions with these simple toolsDuncan, Bob57Holiday201118-19calipersdividerscompasshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
A Monumental MiniatureAnimated carving depicts folk life in SlovakiaRyan, Kathleen57Holiday201122-23folkartslovakiaanimatedhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
A Bird in the HandWoodcarver offers comfort to those in needRyan, Kathleen57Holiday201125comfortbirdfeaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Making a Comfort BirdSmooth lines and polished finish make these little birds a joy to holdFoust, Frank57Holiday201126-27comfortbirdbeginnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Creating a Chip Carved Christmas TreeHighlight this festive plaque with color and delicate stab cutsNicholas, Bruce57Holiday201129-31Chipcarvingchristmastreehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Award-Winning Carvings: Woodcarving Illustrated Best Carving Design ContestContestants show a broad range of creativity and superior craftsmanshipDuncan, Bob57Holiday201132-40Design contestwinnersgalleryhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Carving a Spiral Beard Santa OrnamentUnique ornament will be a family favoriteFrancis, Dave57Holiday201142-45santaspiralbeardhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Whittling Snowman EarringsFun gift is easy to carveFreaner, Claude57Holiday201146-47snowmanearringswhittlehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Carving St. NicholasMaster the techniques to carve this classic Christmas iconEnlow, Harold57Holiday201148-53Santaclassicholiday decorationhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Sculpting Stylized Evergreen TreesGraceful spiral is easy to carve and makes a striking displayCarlson, Dennis57Holiday201154-57treesspiralchristmashttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Build a Dancing SantaTurn the handle to make this carved Santa move and grooveCipa, Shawn57Holiday201158-64Santaautomatachristmashttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Relief Carving an AngelBeautiful wall hanging displays delicate features and graceful fabric foldsHockley, Maureen57Holiday201165-69angelrelief carvinghome decorhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Carving a Low Relief SantaCreate the illustion of depth with careful carving and painted shadowsBiermann, Robert57Holiday201170-76ChristmasSantaRelief carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Making a Nostalgic Christmas Pull ToyAs the toy moves, wooden ball rotates to display the relief carved sceneToney, Tina57Holiday201177-83SantapulltoyChristmashttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Customized Greeting PlaqueAdd a border or message to personalize your designPompano, Deborah57Holiday201185-87woodburningPineconesWelcomehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-57-holiday-2011.html
Whittling SafetyA few simple rules prevent injuries when whittlingDuncan, Bob571Whittling Complete Starter Guide20116whittlingbasicssafetyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Learn the Basic Knife Cuts for WhittlingComplete most projects with four types of cutsDuncan, Bob571Whittling Complete Starter Guide20118whittlingbasicscutsknifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Choosing a Whittling KnifeWhat to look for when selecting a folding knifeDuncan, Bob571Whittling Complete Starter Guide201111whittlingbasicskniveshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
The Basics of SharpeningProperly prepare your knife for safe and enjoyable whittlingDuncan, Bob571Whittling Complete Starter Guide201114whittlingbasicssharpeninghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
5-Minute OwlBeginner project is ideal for teaching and demonstrationsOegema, Jan571Whittling Complete Starter Guide201119owlbeginnerfive minutesimplehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Flying PropellerClassic toy anyone can makeWiebe, Rick571Whittling Complete Starter Guide201122propellerflyingmotiontoyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
5-Minute WizardBeginner project is a great introduction to woodcarvingHindes, Tom571Whittling Complete Starter Guide201124wizardbeginnerfive minutehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Easy Dogs for Beginning CarversUse craft knives to carve thse basic versions of man's best friendGuldan, Mary Duke571Whittling Complete Starter Guide201128dogsbeginnereasyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Santa PencilsTurn ordinary pencils into festive Santas in eight simple stesJohnson, Ron571Whittling Complete Starter Guide201131holidaypencilssantahttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Hand-Carved ClassicsPractice knife carving with a ball-in-cage and chain linksWeaver, Kivel571Whittling Complete Starter Guide201134ball-in-cagechain linksclassichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Heirloom Baby RattlesClassic carving projects make thoughtful giftsHochhalter, Gene571Whittling Complete Starter Guide201136rattlesheirloomtoyschildrenhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Classic Ball-in-CageThis old-time whittling project is fun to carve and a real attention-getterDussinger, Addison ''Dusty''571Whittling Complete Starter Guide201139ball-in-cageclassiccarvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Twisted Spiral OrnamentCarve this seemingly complex design in eight easy stepsKent, Carol571Whittling Complete Starter Guide201142ornamentholidayspiraleasyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Quick Carve SpreaderCarve this useful utensil out of a branch using only a pocketknifeLubkemann, Chris571Whittling Complete Starter Guide201145kitchenspreadertwigshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Whittle a Twig WhistleNew technique reinvents a perennial favoriteLubkemann, Chris571Whittling Complete Starter Guide201148whistletoynew techniquetwigshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Altering a Pocketknife to Whittle TwigsProperly prepare a pocketknife for whittling twigs and branchesLubkemann, Chris571Whittling Complete Starter Guide201151pocketknifecustomizewhittlinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Whittling a Miniature FlowerTurn twigs into delicate flowers with a few simple cutsLubkemann, Chris571Whittling Complete Starter Guide201152flowerdelicatewhittlinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Make a Musical FrogFast and fun project is a unique musical instrumentEllenwood, Everett571Whittling Complete Starter Guide201154toyfrogmusical instrumenthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Simple Starter SantaSpread holiday cheer with this basic designSchuck, Kathleen571Whittling Complete Starter Guide201157holidaysantabeginnersimplehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Build a Nostalgic WhirligigSimple carved features, spinning arms, and a rustic finish make this project a winnerDePauw, Vernon571Whittling Complete Starter Guide201160uncle sampatrioticwhirlygigtoyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Whimsical BookmarksPlayful figures make quick and easy giftLund, Jack571Whittling Complete Starter Guide201166bookmarkshuman bodyplayfulhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Whittling a Decorative Fishing LureSimple project makes a fun display or gift itemIrish, Lora S.571Whittling Complete Starter Guide201170décorfishing lurefishhangerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Carve a Caricature PigCharming character makes an ideal beginner projectCoffman, Christine571Whittling Complete Starter Guide201174pigcaricatureswildlifebeginnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Cyprus Knee SantaUse a unique material to whittle a one-of-a-kind SantaJoslyn, Cyndi571Whittling Complete Starter Guide201178cypress kneeSantaalternative materialsholidayhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Little HombreRustle up this Western caricature with just two toolsStetson, Dave571Whittling Complete Starter Guide201183caricaturewesterncowboyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Carve and Paint a Scandinavian-Style TrollDelve into flat-plane carving with this beginner project from a master carverRefsal, Harley571Whittling Complete Starter Guide201190beginnertrollscandinaviancaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Carving a Native AmericanUse whittling techniques to tackle a traditional carving projectEnlow, Harold571Whittling Complete Starter Guide2011100native americanrealisticportraithttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Fan-Tailed HummingbirdLearn the secrets that unlock this striking techniqueWiebe, Rick571Whittling Complete Starter Guide2011106hummingbirdfantailtechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling.html
Product ReviewDenker Shave and Rotary carverDuncan, Bob58Spring20128Jim Denkerdenker carving shavedenker rotary carverhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Relief ColumnDancing LeavesIrish, Lora S58Spring201214relief carvingspringleaveshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Rising from the AshesBurn survivor John Capanna draws strength and healing from woodRyan, Kathleen58Spring201218-19burnsurviverfeature http://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Motivated to CreateA self-help seminar inspired Phil and Vicki Bishop to quit their jobs and carve full timeRyan, Kathleen58Spring201222-25InspirationCaricaturefeaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Carving Scenic StampsUse traditional stamp-making techniques to share your relief carvings with family and friendsDennison, Carrie58Spring201226-29stamprelief carvingScenichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Carving Interlocking HeartsCreate beautiful linked shapes from a single block of woodJespersen, Bjarne58Spring201230-33heartsinterlockingwhimsyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Tequila Worm Bottle StopperSmall-scale bottle stopper is fun to carverWillis, Jim58Spring201234-36bottlestopperwormtequilahttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Power Carving a Life-Size Whistling SwanBasic technique allows you to create a swan in any sizeMcCollum, Thomas58Spring201237-43swanpower carvingrealistichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
The Work of Rob LuceroLifelong artist creates jewelry based on his various passionsDuncan, Bob58Spring201244-45jewelryfashionartist profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Carving a Cascading Ribbon Heart PendantPower-carved design is easy to makeLucero, Rob58Spring201246-47PendantHeartPower Carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Carving and Painting a Folk Art RoosterVivid colors highlight this nostalgic pull toySwartz, Don58Spring201248-57roosterFolk Artpaintinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Carving a Caricature ElephantBasswood egg reduces the time spent roughing outRhadigan, Floyd58Spring201258-67elephanteggcaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Creating a Pierced Relief Carvign15th-century design has modern appealKatz, Dan58Spring201264-68piercedreliefgothichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Chip Carved CrossesMiniature designs make great ornaments or key chainsNiggemeyer, John58Spring201269-71crosschip carvingreligioushttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Holding Your WorkUse simple methods to secure your blank for easier and safer carvingPye, Chris58Spring201272-79benchholdingshopmadehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Making Custom StainsMix your own dyes and stainsTriplett, RobertDuncan, Bob58Spring201280-81dyesstainsmixinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Folding Carving BenchSturdy carving bench packs easily for travelSchmauch, Jack58Spring201283-86benchfoldingshopmadehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-58-spring-2012.html
Product ReviewDMT Dia-Flat Lapping Plate and Micro Pro Champion Micro MotorDuncan, Bob59Summer201214DMT Dia-Flat Lapping Plateflattening sharpening stonesMicro Pro Champion micro motorpower carving
Relief ColumnScraffito SwanIrish, Lora S59Summer201216swanscraffitorelief
Best of ShowTop winners from three popular carving competitionsDuncan, Bob59Summer201219-22carvingcontestwinners
Custom Carved GuitarsDoug Rowell traded making music for making musical instrumentsRyan, Kathleen59Summer201224-27guitarsmusicartist profile
The Art of WoodBilly Reynolds carves to enhance naturally sculpted woodKinsey, Mindy59Summer201228-29foundwoodfeature
Creating a Log Picture BookTurn a log into a book using simple pierced-relief techniqueEllery, Roy59Summer201230-35logbookpiercedrelief
Carving a Sleepy OwlUse guidelines to create a balanced and symmetrical carvingSavarese, Joseph59Summer201236-40owlsleepytechnique
Carving a Realistic Shirt BoxFunctional box provides good practice in creating texturesAvarista, Joe A.59Summer201241-47Shirtleatherbox
Carving a Caricature Beer BottleAdd a fun cowboy carving to a turned bottleRhadigan, Floyd59Summer201248-53cowboybeerbottlecaricature
Carving a Box TurtleUse texturing and a woodburner to create a realistic reptileGoodson, Dylan59Summer201254-61turtlerealistickeepsake
Carving a Rattle StickCombine wood spirits with a ball-in-cage to create a unique walking stickBuchholz, Steve59Summer201262-66wood spiritwalking stickball in cage
Carving a Dragon HeadModify a staple remover to create a fierce but functional dragon for your deskBorecki, Tom59Summer201267-71dragonstaple removeroffice decor
Sharpening with PowerUse inexpensive power tools to get a sharp edge fastProffitt, Mac59Summer201272-75sharpeningbelt sanderpower
Whittling a Tabletop Bowling SetUse twigs and scraps to craft this small set in an eveningLubkemann, Chris59Summer201276-77bowlingwhittlingtwigs
Applying a Shellac FinishEasy-to-apply finish is great for chip carvingStewart, David59Summer201278-81shellacfinishchip carving
Making Realistic Wooden EyesQuick and easy method uses contrasting dowelsKunz, Ray59Summer201282-84eyesdowelsstylized
Shop lightsImprove your carving experience with proper lightingDuncan, Bob59Summer201286lightingshoptips
Product ReviewBlaklader workwear and Lucas Dental Low Boy Speed Control PedalDuncan, Bob60Fall201214Blaklader WorkwearLucas Dental Low Boy Speed Control Pedalpower carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Relief ColumnFree-Form Chip CarvingIrish, Lora S60Fall201216-17chip carvingfree formreliefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Saluting the BestAnnouncing the winners of the 2012 Best Carving Design ContestKinsey, Mindy60Fall201218-25designcontest winnersgalleryhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
2012 Woodcarver of the Year Harley RefsalHonoring the flat-plane carving pioneer for keeping a dying art aliveDuncan, Bob60Fall201226-29refsalharleyWoodcarver of the Yearhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Learn to Carve in Low ReliefThese progressively harder projects teach basic relief techniquesPye, Chris60Fall201234-39leavesleafreliefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Creating a Layered Relief CarvingCombine individually carved layers to add depth and dimension to your workCulley, Wayne60Fall201240-45relieflayeredhousetreeshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Unique Bark Houses in the RoundNew technque combines two pieces of bark to create freestanding carvingsJensen, Rick60Fall201246-53barkhousein the roundhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Whittling Love SpoonsQuick and east project makes a meaningful gift for a loved oneWestern, David60Fall201254-57spoonwhittledhearthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Quick & East Ark AnimalsUse one technique to power carve an assortment of animals two by twoHindes, Tom60Fall201258-62arknoahanimalshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Creating a Tricky TrollCrafty caricature hides a sinister surpriseRhadigan, Floyd60Fall201263-65trollfantasycaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Carving a Woman's EyesLearn to carve these difficult but expressive featuresNorbury, Ian60Fall201266-69eyeswomenrealistichttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Making a Caricature Amish ManLearn to carve this iconic figure in 20 stepsDearolf, Don60Fall201270-76AmishCaricatureStep by Stephttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Quick-carve Pumpkin HouseSimple steps turn a bark house into a festive jack o'lanternJackson, TimCabot, Dennis60Fall201278-80barkhousepumpkinhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Carving a Caricature CanineUse a premade blank and simple cuts to carve this adorable dogDickie, Lorie60Fall201282-84dogeggbasswoodcaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Using a Carving ArmHow--and why--to attach a project to a carving armSidler, LaVerne Sid60Fall201286-88safetycarvingarmhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-60-fall-2012.html
Artist GalleryDiscover amazing artworks from notable pyro artistsStaffPYRO2012Fall201212Woodburning, Artist ProfileGalleryhttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Museum QualityFirst-of-its-kind exhibit showcased pyrography as fine artMcCauley, CatePYRO2012Fall201220WoodburningArtist ProfileArt https://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Pyrographic PortraitsAlex Yawor used portrait painting techniques to teach himself pyrographyKinsey, MindyPYRO2012Fall201224Woodburning, PaintPeoplehttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Inspired by NatureAustralian artist Scott Marr describes his pyrography and pigmentsKinsey, MindyPYRO2012Fall201226WoodburningArtist ProfileWildlifehttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Pattern Making Made EasyUse your computer to turn a photo into a patternSmith, DanettePYRO2012Fall201242WoodburningTechniquesPatternshttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Making a Practice BoardTest temperatures and practice patterns before beginning any pyrographic projectSchwartz, JoPYRO2012Fall201246WoodburningTechniquesTesthttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Color-Full BurnsAdding color to woodburned creationsAdams, CindyPYRO2012Fall201249WoodburningColor techniquehttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Making Patterns from Multiple PhotosCombine images to create unique artwork and imaginary landscapesLindsey, DorisPYRO2012Fall201252WoodburningTechniquesPatternshttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Pyrography on PaperFor ease, versatility, and affordability, consider a different burning materialMcCauley, CatePYRO2012Fall201256WoodburningTipsAlternative Materialshttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Layering Pigments and PyrographyBring this young dragon to life with rich colors and shadingStanley, DavidPYRO2012Fall201260WoodburningDragonPaintinghttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Depicting Day and NightUse negative pyrography to create contrasting light effectsWalters, SuePYRO2012Fall201265WoodburningNegativeTechniquehttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Burning Wood BanglesMake a bracelet today, wear it—or gift it—tonightEaston, SuePYRO2012Fall201274WoodburningJewelryFashionhttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Creating a Gourd BasketBeautiful basket combines basic carving and pyrography techniquesZanella, SusanPYRO2012Fall201276WoodburningGourdWeavehttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Burning a Butterfly BirdhousePractice dark shading with this lighthearted designRayyan, SheilaPYRO2012Fall201280WoodburningBirdsPracticalhttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Zentangle®-Inspired BoxDecorate a box with folk-art imagery and simple patternsWallace, ChrisPYRO2012Fall201284WoodburningKeepsakePaint https://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Creating a Decorative PlatterLayers of burning, images, text, and color combine to create Soul MatesPompano, DeborahPYRO2012Fall201288WoodburningSwansScenichttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Personalized Gifts for CooksMake inexpensive gifts by burning on store-bought kitchen toolsParsons, MichelePYRO2012Fall201295WoodburningKitchenHome Decorhttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Making Scrapbook TagsUse trinkets and trash to make unique tagsIrish, LoraPYRO2012Fall2012103WoodburningButterflyReusehttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Hatteras and Horseshoe CrabsUse sketching techniques and hints of color to create a dreamy landscapeLindsey, DorisPYRO2012Fall2012100WoodburningNorth CarolinaSeasideLighthousehttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Stamping a Flowered FrameUse pyrography tips as stamps to create easy designsGlista, AnnePYRO2012Fall2012106WoodburningHome DecorFlowershttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Burning a Wolf PortraitTips for creating a realistic wildlife portraitWorden, DonPYRO2012Fall2012108WoodburningAnimalsDogshttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Steampunk Key FobMake a quick craft from leftover leatherIrish, LoraPYRO2012Fall2012110WoodburningLeatherKeyshttps://www.foxchapelpublishing.com/pyrography-2012-special-issue.html
Relief ColumnVersatile SnowmanIrish, Lora S61Holiday201214relief carvingchristmassnowmanhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Checking the ListUse basic relief cuts and simple shaping to carve a folk art SantaOlson, Ellis61Holiday201218SantaFolk ArtReliefhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Carving a Spiral Bulb OrnamentAny carver can make this complex-looing ornamentMorgan, Lyle61Holiday201222bulbspiralOrnamenthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Carving and Printing a Christmas CardUse traditional woodblock printing to turn your carving into a cardClarke, Dan61Holiday201226cardChristmascardhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Carving a Sleepy WolfCarve, burn, and paint to create a realistic wildlife sculptureHajny, Desiree61Holiday201230wolfrealisticwoodburninghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Folk Art AngelSimple carving can be used as an ornament, pin, or pendantSmith, Gerald61Holiday201237angelFolk Artornamenthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Joyful Santa PlaqueIncised relief design celebrates the joy of the seasonBiermann, Robert61Holiday201238SantaJoyPlaquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Whittling Moravian Star OrnamentsUse one knife and simple geometry to carve stars in various shapesSebring, Jody61Holiday201244starornamentwhittlinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Peaceful Village WreathCarve individual pieces and glue them together for a dramatic presentationPadden, Betty61Holiday201248wreathcarvedoil paintshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Easy Dogs for Beginner CarversUse craft knifes to carve these basic versions of man's best friendGuldan, Mary Duke61Holiday201256dogcraft knifebeginnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Old World Father ChristmasCozy-looking carving carries symbols of ChristmasFrancis, Dave61Holiday201259SantaOld Worldchristmashttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Segmented Snowman OrnamentSimple joints help this snowman danceSmith, Sandy61Holiday201264SnowmanJointedOrnamenthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Painting Your CarvingsLearn techniques you can apply to any carvingKodadek, Virginia61Holiday201268dollpaintingtechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Convertible Shaving HorsePortable bench changes from shaving horse to carving benchSidler, LaVerne Sid61Holiday201274benchshaving horseshophttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Carving a Holly SpoonSimple painting highlights the attractive designStewart, Glenn61Holiday201280spoonhollypractical http://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Springerle OrnamentsFestive designs resemble traditional German Christmas cookiesNiggemeyer, John61Holiday201286chip carvingornamentscookieshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-61-holiday-2012.html
Relief ColumnThe Celtic Cross-Endless KnotsIrish, Lora S62Spring201314relief carvingcelticreligioushttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Realistic CreativityArtist goes out on a limp carving rusted metal perches for realistic birdsDorsch, Susan62Spring201318birdsmetalrustyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Carving a Cross NecklaceBall-in-cross and attached chain are carved from a single piece of woodDodge, James O.62Spring201322chaincrossball-in-crosshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Making Bamboo Walking SticksAdd a carved topper to a ready-made shaft for an easy personalized stickIrish, Lora S62Spring201326walking stickbamboocaneshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Comical Cowboy RoosterColorful shelf-sitter cowboy perches with help from easy-carve jointsFeather, Jim62Spring201330roostercaricaturejointshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Whimsical Bark HouseScale and adapt the design to suit any cottonwood barkJensen, Rick62Spring201338barkhousewhimsicalhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Dragon Tray PuzzleCarved puzzle play set fits into a castle-shaped boxHower, Carolea62Spring201343dragoncastlepuzzlehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Making a Realistic Bluegill PinUse power carving tools and an airbrush to create a realistic fish pinArndt, Dave62Spring201350bluegillfishpinpower carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Carving an Angry FaceAdd emotion to a face by carving key features differentlyEnlow, Harold62Spring201355angryfacecaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Heartfelt Door TopperCombine easy relief carving and oil painting to make a decorative door topperPadden, Betty62Spring201360doortopperreliefoil painthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Carving a Leprechaun PencilLearn to carve caricature faces in 10 easy stepsTrue, Randy62Spring201367pencilleprechanirishhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Relief PyrographyCombine relief carving with woodburning to create a portrait with depthJones, Chip62Spring201370pyrographyreliefportraithttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Practicing PatienceFor Walt Nichols, the most intricate woodcarving is always worth the waitFitzgerald, Toni62Spring201376intricateeggsshellspower carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
No Vision RequiredBeing blind doesn't keep these woodworkers from building and carvingRyan, Kathleen62Spring201378blindwoodworkersfeaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Pro's guide to 29 Finishing SuppliesMust-have tools for finishing all types of woodworking projectsSouthwick, Kevin62Spring201384finishingtoolsshophttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-62-spring-2013.html
Relief ColumnHungry ChicksIrish, Lora S63Summer201316relief carvingwildlifebirdshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
2103 Woodcarver of the Year: Fred CogelowCombing relief techniques with realism to create fine-art carvingsDuncan, Bob63Summer201320Cogelowwinnersartist profilehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Folk-Art Fish KeychainsSimple designs are easy to carve and fun to paintReichling, John63Summer201324folkartfishkeychainhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Bring Home a Garden GnomeMake a mascot that's sure to bring good luckRhadigan, Floyd63Summer201328gnomecaricaturefantasyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Carving an AcornRealistic habitat accent teaches texturing techniquesClark, Butch63Summer201335acornhabitatrealistichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Best of ShowAppreciating some of the best carvings in the country Plust 10 more great showsStaff63Summer201338contestshowsgalleryhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Pocket-size GremlinsPractice exaggerated facial features with these funny fellowsBorecki, Tom63Summer201344gremlinscaricaturewhittlinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Making a Rustic Measuring CupPower carve a cup from salvaged woodDrake, David63Summer201348measuring cuplizardpowerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Making a Realistic BeaverCombine carving, woodburning, and painting to make an adorable animalGoddard, Leah63Summer201352Beaverrealisticwoodburninghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Carving Decorative ElementsLearn to carve rope, molding, a lettered banner, and a scalloped shellPye, Chris63Summer201360ropemoldinglettersshellhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Sunken GreenmanReverse relief'' design is an easy introduction to relief carvingIrish, Lora S63Summer201366greenmanreliefbeginnerhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Carving a DollLearn to carve children's faces by making a jointed dollDenton-Cordell, Janet63Summer201370dollchildfacehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Fun & Easy Flag PinMake this patriotic project in an afternoonOliver, Steve63Summer201379flagpinpatriotic http://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Simple SunflowerPractice basic carving techniques with this attractive projectZongker, Dennis63Summer201382sunflowerrelieffloralhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
Product ReviewBushSmarts Carving Tools and Losable KnivesDuncan, Bob63Summer201388bushsmartcarving toolslee valleychestnut toolslosable kniveshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-63-summer-2013.html
The Wonderful Wizard of OregonGary Burns uses self-taught techniques to carve out a fantastic nicheFitzgerald, Toni64Fall201318Burnscarvingoregonhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Relief ColumnGrapes on the VineIrish, Lora S64Fall201314relief carvinggrapestechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Chip Carving an EaglePractic basic chip carving techniques with this patriotic designIrish, Lora S64Fall201322Chipcarvingeaglehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Carving a Wood SpiritDetailed instructions for carving your first wood spiritEnlow, Harold64Fall201325wood spiritenlowlive edgehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Back to SchoolLearn to carve or hone your skills at schools and classes across the countryKinsey, Mindy64Fall201330classesschoolskidshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Power Carve an American Bison in ReliefLear the techniques to carve a gunstock on a less expensive wooden plateValencia, Jose64Fall201332bisonpower carvingreliefhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Story TimeCarlo Olkeriil tells American stories in a traditional Palauan styleRyan, Kathleen64Fall201337palaustoriesnativehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Carving a GoldfinchPractice power carving by making this popular songbirdGuge, Bob64Fall201338goldfinchbirdpower carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
A Fantasy FavoriteCustomize this caricature wizard by changing the staff and paint colorsDearolf, Don64Fall201343wizardcaricaturepaint http://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Double-sided Holiday OrnamentIngenious Santa/Turkey ornament is a real attention getterStewart, Glenn64Fall201346turkeysantapinornamenthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Carving a Caricature HorseWeary old nag is a great companion for any cowboy carvingStetson, Dave64Fall201350naghorsecaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Carving Like ManiacsTurning a Halloween hobby into a pumpkin-carving businessStellhorn, Ayleen64Fall201354pumpkincarvingbusinesshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Carving Kris KringleGet a head start on your holiday carving with this simple SantaMason, Bob64Fall201356SantaKrisKringleCaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Caving a Native American EyeTechniques for capturing the distinctive shape of these special eyesBurke, John64Fall201361nativeamericaneyehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Carving a Little GuyLearn to carve a basic figure and then personalize it as much as you likeRandich, Keith64Fall201366boxercaricaturetechniquehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
CNC Woodworking & Laser CuttingComputer-controlled routers and lasers speed production for repetitive cutsDuncan, BobKinsey, Mindy64Fall201368CNCrouterlaserhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Carving a ChipmunkCarve, burn, and paint this realistic version of a backyard visitorHajny, Desiree64Fall201374Chipmunkrealisticwildlifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-64-fall-2013.html
Great Gourds! Pyrographer Jenn Avery uses a unique canvas for her exquisite designsFitzgerald, ToniPYRO2013Fall201314GourdsWoodburning Galleryhttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Pyrography GalleryRyan, KathleenPYRO2013Fall201318WoodburningWildlifeArtist Profilehttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Artist ProfilesMeet artists Cate McCauley, Ivaylo Hristov, Kathleen Marie, and Songda OuedraogoRyan, KathleenPYRO2013Fall201319WoodburningScenicWildlifehttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Burning a Dark BackgroundEmphasize the highlights in a burning by creating a contrasting backgroundRobinson, MinisaPYRO2013Fall201326WoodburningWildlifetechniquehttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Practicing PointillismUse strippling (dots) to create a realistic design on a turned eggWalters, SuePYRO2013Fall201330WoodburningElephant EyeEggTechniquehttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Burning Realistic EyesPractice and perfect your technique for creating eyesSchwartz, JoPYRO2013Fall201334WoodburningRealisticEyeshttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Preparing a GourdSimple steps to safely prepare a gourd for craftingZanella, SusanPYRO2013Fall201336Woodburning GourdsSafetyhttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Creating a ReflectionLearn how to capture the look of a reflection in waterSchwartz, JoPYRO2013Fall201340WoodburningTipsWildlifehttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Relief PyrographyCombine relief carving with woodburning to create a portrait with depth Jones, ChipPYRO2013Fall201344WoodburningReliefHorsebackhttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Pyrography on CanvasSimple advice for burning on—but not through—clothDenison, NedraPYRO2013Fall201350WoodburningClothesRosehttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Crazy Quilt SamplerLearn about tips and textures by making a pretty but practical practice boardPompano, DeborahPYRO2013Fall201352WoodburningPractice BoardTipshttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Embellishing BeadsMake interesting wearable art by burning a commerical beadWalters, SuePYRO2013Fall201359WoodburningJewelrytechniquehttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Somewhere West of LaramieClever use of wood grain simulates ripples in waterOwen, AdamPYRO2013Fall201362WoodburningReflectionHorse https://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Colorful Fall PumpkinWoodburn on paper and add colors with oil pencilsSmith, DanettePYRO2013Fall201366WoodburningHalloweenPatternhttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Making a Meditation LanternCombine a simple frame with woodburned paper panels to create a luminariaParsons, MichelePYRO2013Fall201369WoodburningWord ArtInspirationhttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Whitetail DeerStunning detail captures the spirit of this forest residentNutting, J.R.PYRO2013Fall201374WoodburningWildlifeScenichttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Graceful Leaf GourdTurn a hard-shelled gourd into a bowl embellished with pyrography and inksZanella, SusanPYRO2013Fall201380WoodburningGourdLeafhttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Burning a Classic Leather Mouse PadDetailed design decorates this functional projectParsons, MichelePYRO2013Fall201384WoodburningOffice DecorPractical https://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Pyrography PrismsAdd color to make your pyrography popRede, SandraPYRO2013Fall201388WoodburningStarPatternhttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Cool Case for Mobile DevicesCustomize your phone or tablet with a cover design inspired by crop circlesEaston, SimonPYRO2013Fall201390WoodburningiPhonePractical https://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Soothing Sea ShellsUse shading, not lines, to show the texture of these shellsSchwartz, JoPYRO2013Fall201394WoodburningNauticalPatternhttps://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Zentangle-style Leather CoastersUse permanent markers to add color to these coastersParsons, MichelePYRO2013Fall201396WoodburningHome DecorPractical https://www.foxchapelpublishing.com/pyrography-volume-3-2013.html
Product ReviewSjobergs Smart Vise and Dremel 4200 Rotary ToolDuncan, Bob65Holiday201314Sjobergssmart viseDremel4200 rotary toolhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Carving a SnowmanTurn a generic basswood shape into a charming snowmanDickie, Lorie65Holiday201322snowmaneggwinterhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Making a Mouse in a Stocking OrnamentCute ornament shows off your attention to detail and realistic carving skillsGoddard, Leah65Holiday201327mousestockingrealistichttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Playful Reindeer OrnamentCarve this quick and easy ornament for everyone on your listRhadigan, Floyd65Holiday201332reindeercaricatureornamenthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Against the GrainBook and exhibition showcase unusual designs in woodKinsey, Mindy65Holiday201336bookexhibitionmuseumhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Folk Art Napkin RingsCarve and paint these colorful pieces in an afternoonPretz, Jeff65Holiday201338napkinringsfolk-arthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Simple Folk Art SantaMake a unique band saw blank and complete the carving in a weekendDeiter, Mike65Holiday201342SantaCaricatureFolk Art http://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Carving in KenyaAfrican artist creates a sucessful business teaching others to carveDuncan, Bob65Holiday201348AfricaKenyabusinesshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Carving a ZebraKenyan carver creates a stylized zebraKirimi, Moses65Holiday201351zebraAfricaStylizedhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Tramp Art Christmas TreeSimple seasonal design is quick and easy to carveDiPace, Andy65Holiday201354treetramp artchip carvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Relief Carving a Traditional OrnamentVersatile design can be a pin or an ornamentStewart, Glenn65Holiday201356ornamentpinreliefhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Whittling a SantaUse just a knife to care most of this holiday favoriteIhlenfeldt, Gayle65Holiday201360santawhittleholiday decorationhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Miniature MarvelsDalton Ghetti carves intricate designs in pencil graphiteRyan, Kathleen65Holiday201366pencilleadtinyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Roughouts & KitsGet to the fun part faster by starting with a pre-cut blankDuncan, Bob65Holiday201368roughoutskitsProduct Reviewhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Carving a Double Ball-in-CageUse hand tools to create a whimsical but exacting projectSavarese, Joseph65Holiday201370ball-in-cageornamentwhimsyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Carving a Baby ShoeCommemorate a birth or first Christmas with a unique version of a traditional giftHawrey, Howard65Holiday201375shoeornamentbabyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Carving a Realistic RaccoonCreate a realistic project by carving, woodburning, and paintingHajny, Desiree65Holiday201378raccoonrealisticwildlifehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/woodcarving-illustrated-issue-65-holiday-2013.html
Choosing a Whittling KnifeWhat to look for when selecting a folding knifeDuncan, BobWHITSIP2013Whittling Vol. 220138whittlingbasicskniveshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Whittling SafetyA few simple rules revent injuries when whittlingDuncan, BobWHITSIP2013Whittling Vol. 2201310whittlingbasicssafetyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Learn the Basic Knife Cuts for WhittlingComplete most projects with four types of cutsDuncan, BobWHITSIP2013Whittling Vol. 2201312whittlingbasicsknife cutshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
The Basics of SharpeningProperly prepare your knife for safe and enjoyable whittlingDuncan, BobWHITSIP2013Whittling Vol. 2201314whittlebasicssharpeninghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Comfortable CarvingSimple changes and stretches make it comfortable to carve for long periods of timeSwartz, DonWHITSIP2013Whittling Vol. 2201316whittlingcarvingcomfortneck painback painhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Teaching Kids to CarveSimple suggestions make it fun and easyKinsey, MindyWHITSIP2013Whittling Vol. 2201319whittlingkidsfuneasyhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
The Art of Carving SoapSoap carving isn't just for kidsRyan, KathleenWHITSIP2013Whittling Vol. 2201320soapcarvingtop soap carvershttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Carving a Soap WhaleSimple shape is a great beginner projectMesser, GeneWHITSIP2013Whittling Vol. 2201322beginnersoapcarvingwhalehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Swirling Spool Ball-in-CageThis variation on a traditional project is fun to carve and looks impressiveGlenz, CliffWHITSIP2013Whittling Vol. 2201326traditionalspoolball-in-cagehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Carving a Whimsey OrnamentCombine a spiral, swing, swivel, and links into one fun projectFreer, FrankWHITSIP2013Whittling Vol. 2201330ornamentwhimseyswingswivellinkshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Five Balls in a CageAdd embellishments to make a classic carving more challengingZanauskas, PeteWHITSIP2013Whittling Vol. 2201334ball-in-cageclassiccarvinghttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Nesting Measuring SpoonsCarve two spoons and a ring from a single piece of woodHiser, JimWHITSIP2013Whittling Vol. 2201337kitchenmeasuring spoonssingle piece of woodutensilhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Carving a BootSimple instructions for carving a classic beginner projectHiser, JimWHITSIP2013Whittling Vol. 2201340cowboy bootbeginnerwesternhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Working Wooden Pliers-based on a traditional design made famous by Ernest WartherUse a sharp knife and careful cuts to make a miniature toolStaffWHITSIP2013Whittling Vol. 2201343miniature toolsingle piece of woodinterconnectingpliershttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Whittling Moravian Star OrnamentsUse one knife and simple geometry to carve stars in various sizesSebring, JodyWHITSIP2013Whittling Vol. 2201346moravian starholidaysgeometryhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Whittling LovespoonsQuick and easy project make a meaningful gift for a loved oneWestern, DavidWHITSIP2013Whittling Vol. 2201350lovespoontraditionalelegantgifthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Carving Interlocking HeartsCreate beautiful linked shapes from a single block of woodJespersen, BjarneWHITSIP2013Whittling Vol. 2201354single piece of woodinterlockingheartshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Whittling a Branch RoosterTurn a twig into a classic carvingLubkemann, ChrisWHITSIP2013Whittling Vol. 2201358wildliferoosterbranchroosterhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Americana Eagle Walking StickFolk-art walking stick was inspired by historic carvingsCipa, ShawnWHITSIP2013Whittling Vol. 2201363walking stickeagleamericanafolk-arthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Farmyard Animal PatternsCreate ornaments or freestanding toys from these simple designsBertils, IreneWHITSIP2013Whittling Vol. 2201368wildlifefarmanimalsornamentshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Eagle Neckerchief SlidePatriotic project is easy for kids and still satisfying for adultsReitmeyer, RobertWHITSIP2013Whittling Vol. 2201372neckerchiefboy scoutsbald eaglehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Carving Java JohnUse large flat planes to emphasize exaggerated featuresRefsal, HarleyWHITSIP2013Whittling Vol. 2201376caricatureflat-planeexaggerated featureshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Carving a Tiny HippoPractice carving animal caricatures with this funny miniatureTomashek, SteveWHITSIP2013Whittling Vol. 2201383wildlifehippocaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Carve Your First Wood SpiritSimple method uses triangles to make it easyCalder, JimWHITSIP2013Whittling Vol. 2201386woodspiritbeginnertriangle blankhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Man in the MoonSimple carving uses just a knife and a scrap of basswoodStetson, DaveWHITSIP2013Whittling Vol. 2201389moonbasswoodcaricaturescrapshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Play With Your FoodCarve fun faces from sweet potatoesJensen, RickWHITSIP2013Whittling Vol. 2201392sweet potatocaricaturescarvingslicing cuthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Whittling a GnomeLearn to mak a standing gnome, and then try your own variationsHindes, TomWHITSIP2013Whittling Vol. 2201396gnomebeginnercaricaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Whittling a NuthatchUse a utility knife to carve a charming folk-art birdCutts, GlynWHITSIP2013Whittling Vol. 22013100wildlifenuthatchbirdshttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Making Miniature GargoylesTiny but fierce figures can protect your computer or coffee tableHindes, TomWHITSIP2013Whittling Vol. 22013104gargolyesbeginnerminiaturehttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Heart-Shaped Bottle StopperSimple stopper makes a great giftYoung, GregWHITSIP2013Whittling Vol. 22013108bottle stopperheartsgifthttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Cupid's ArrowMake a unique version of a classic carvingRandich, KeithWHITSIP2013Whittling Vol. 22013110classicheartsarrowhttp://www.foxchapelpublishing.com/magazines/wood-carving-illustrated/whittling-volume-2-2013.html
Norwegian-style Wooden ChainA different take on the standard carved wooden chainWestern, DavidWHITSIP2014Whittling Vol. 3201410wooden chainnorwegian-stylechainwhittling
Ball-in-Cage Letter OpenerCarve a useful tool embellished by a classic designZanauskas, PeteWHITSIP2014Whittling Vol. 3201412letter openerball-in-cageusefulgift
Impossible Dovetail PuzzleClassic whittling project makes a fun puzzleStewart, DavidWHITSIP2014Whittling Vol. 3201415puzzledovetailimpossible
Stompin' Boot OrnamentNaught, nice, or a little of each? Fun ornament lets you decideFenton, GaryWHITSIP2014Whittling Vol. 3201416ornamentbootwhittling
Spiral Icicle OrnamentsChange the look--and the challenge--by carving more spiralsSebring, JodyWHITSIP2014Whittling Vol. 3201418ornamentsiciclespiral
Twisted Ball-in-CageCarve this modern take on a classic whimsyLeFave, EdWHITSIP2014Whittling Vol. 3201420ball-in-cagewhimsytwisted
Ball-in-Cage RattleAttractive rattle combines three classic designsEgholm, FrankWHITSIP2014Whittling Vol. 3201424rattleball-in-cagetoy
Soap Zoo AnimalsTeach youngsters the basics of carving without the risk of cutsBolyard, JanetWHITSIP2014Whittling Vol. 3201426soap carvingalternative materialsanimalswildlife
Teaching Kids to CarveSimple suggestions make it fun and easyKinsey, MindyWHITSIP2014Whittling Vol. 3201429carving with kidsnext generationsimplebeginners
Introducing Potato WoodManufactured material made from potato starch is forgiving and easy to carveTomashek, SteveWHITSIP2014Whittling Vol. 3201430potato woodalternative materialswhittling
Quick Campfire ForkTurn any twig into a useful cooking utensil in just six stepsLubkemann, ChrisWHITSIP2014Whittling Vol. 3201434utensilcamp forkwhittlingeasy
Carving a Neckerchief SlideClassic Boy Scout project can easily become a magnet or pinReitmeyer, BobWHITSIP2014Whittling Vol. 3201436neckerchief slidecarvingboy scouts
XO ChainTurn a classic whittling project into an expression of loveProseilo, JackWHITSIP2014Whittling Vol. 3201438whittlingchaininterlockingvalentines
Ozark Caricature PinPractice carving caricatures with this cute country faceMorgan, ChrisWHITSIP2014Whittling Vol. 3201441caricaturespinozark
Bark Pine TreesUse cottonwood bark scraps to create whimsical pine tree magnetsElswit, BetsyWHITSIP2014Whittling Vol. 3201442cottonwood barkpine treesmagnets
Pinhead Whittle FolkTurn clothespins into caricatures in five simple stepsMertz, Donald K.WHITSIP2014Whittling Vol. 3201444caricaturesclothespinsalternate materials
Shaping a ShamrockPractice carving thin curves by making a lucky pinMoore, John W.WHITSIP2014Whittling Vol. 3201446shamrockwhittlingminiaturepin
Make Your Own MonsterCombine critter parts to create your own imaginary monsterTomashek, SteveWHITSIP2014Whittling Vol. 3201448monstercarvingimaginarywhittling
Pencil Wood SpiritsTurn standard pencils into whimsical wood spiritsAnderson, TerryWHITSIP2014Whittling Vol. 3201451whittlingpencilscaricatures
Whittling a PelicanStylized bird is the symbol of summerCoffman, ChristineWHITSIP2014Whittling Vol. 3201454pelicanbirdwhittlingsummer
Uncle Sam & FriendsOne pattern makes 4 fun figuresHindes, TomWHITSIP2014Whittling Vol. 3201456uncle sampatrioticwhittling
Caricature SnowmanStart your holiday carving early with this fun designYoung, GregWHITSIP2014Whittling Vol. 3201458snowmanholidayscaricature
Whittle a Twig TreeShave curly boughs to create a miniature evergreenLubkemann, ChrisWHITSIP2014Whittling Vol. 3201460whittlewhimsytreetwig
Mocha MaryCarve this delightful coffee shop owner and customize her with glued-on accessoriesRefsal, HarleyWHITSIP2014Whittling Vol. 3201463caricaturecoffee shopwhittling
Celtic KnotworkSimple design can be a brooch, pendant, or ornamentWestern, DavidWHITSIP2014Whittling Vol. 3201466celticknotworkornamentjewelry
Teddy Bear OrnamentCreate this whimsical ornament in a weekendEllis, TomWHITSIP2014Whittling Vol. 3201468ornamentteddy bearsock
Unicorn Letter OpenerA fun and functional fantasy carvingElswit, BetsyWHITSIP2014Whittling Vol. 3201472unicornletteropenerfantasy
Easy-Carve SantaSimple Santa is quick to carve and fun to giveHindes, TomWHITSIP2014Whittling Vol. 3201474santaholidaysbeginner
Carving an AngelFan-style wings make this whittling project stand outWiebe, RickWHITSIP2014Whittling Vol. 3201475angelholidaysfan-stylewhittling
Hand-Hewn Wooden CupRustic cup is traditional, functionl, and sensibleWiebe, RickWHITSIP2014Whittling Vol. 3201480wooden cupwhittlingrustic
Choosing a Whittling KnifeWhat to look for when selecting a folding knifeDuncan, BobWHITSIP2014Whittling Vol. 3201486whittlingbasicsknives
The Basics of SharpeningProperly prepare your knife for safe and enjoyable whittlingDuncan, BobWHITSIP2014Whittling Vol. 3201488whittlebasicssharpening
Comfortable CarvingSimple changes and stretches make it comfortable to carve for long periods of timeSwartz, DonWHITSIP2014Whittling Vol. 3201490whittlingcarvingcomfortneck painback pain
Whittling SafetyA few simple rules revent injuries when whittlingDuncan, BobWHITSIP2014Whittling Vol. 3201494whittlingbasicssafety
Learn the Basic Knife Cuts for WhittlingComplete most projects with four types of cutsDuncan, BobWHITSIP2014Whittling Vol. 3201496whittlingbasicsknife cuts
Product ReviewZippo 4-in-1 Woodsman, Gerber Three-Blade Stock Knife, Case Seahorse WhittlerDuncan, Bob66Spring201412ZippomultitoolGerberthree-blade knifeCase Cutleryhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Turning Over a New LeafUpcycle a vintage wooden bowl with power-carved leavesMcCaffrey, Keoma66Spring201419power carvebowlleafhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Stunning Soap CarvingExperts turn simple soap into works of artRyan, Kathleen66Spring201424alternate materialssoapgalleryhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Carving a Soap FlowerSoft and lacking grain, a bar of soap is easy to carveWagner, Sue66Spring201426alternate materialssoapflowershttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Little StinkerAmusing skunk caricature is easy to customizeHershey, Bob66Spring201428caricaturewildlifeskunkhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Fantastic WizardStylized Design is easy to carve and customizeCipa, Shawn66Spring201435wizardbeginnercaricaturehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Chip-Carved Bread BoardCustomize the design to make a personalized kitchen decorationBarton, Wayne66Spring201438chip carvingkitchenbreadboardhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Floral Love SpoonCombine power carving with hand tools to make this attractive projectOnslow, Barry66Spring201445power carvinghand carvinglovespoonhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Celtic Twist Green ManCombine Celtic knotwork with a traditional green man for a modern relief carvingIrish, Lora S66Spring201450reliefcelticgreen manhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Carving and Turning: LathesMake your own carving blanks while learning a new hobbyDuncan, Bob66Spring201452woodturninglathesshopmadehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Scrambled EggsTransform turned eggs into whimsical fishReichling, John66Spring201454woodturningeggsfishhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Carving a Northern CardinalUse disposable blades to carve this colorful songbirdEveritt, Terry66Spring201460wildlifebirdsdisposable bladeshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Learn to Paint: Spring TulipsPractice painting with this new series; start by learning about acrylic paints, brushes, and blendingPadden, Betty66Spring201466paintingbeginnerflowershttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Carving a Native AmericanRealistic Western icon is simple but powerfulMartin, Stu66Spring201470native americanrealisticbeginnerhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Power Carving a Morning GloryUse a delicate touch to carve this stunning flowerMarsh, Wanda66Spring201476power carvingflowerstechniquehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
Want-A-BeA fun caricature of a mule who wants to be so much moreThornton, Dennis and Susan66Spring201486caricaturewildlifemulehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-66-spring-2014.html
The Next Generation of WoodcarversMeet six award-winning young carversRyan, Kathleen67Summer201416carvingkidsfeaturehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Whittling Summer EarringsSimple designs will delight all summer longLuxbacher, Pete67Summer201420whittlingjewelryearringshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Bill's Smile Walking StickAdd a friendly wood spirit to your walking stickBryant, Dick67Summer201422walking stickwood spiritcaneshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Outdoor Finishes and GluesUse the right products to ensure your outdoor projects lastDuncan, Bob67Summer201426outdoorfinishestipshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
The Work of Mavasta HonyoutiHopi carver carries on the tradition in cottonwood rootsGarbers, Alan67Summer201428cottonwood rootsHopi carverartist profilehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Making a Hook KnifeTurn an old saw blade into a useful carving knifeCariboo Blades67Summer201431hook knifeupcycleshopmadehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Carving Folk-Art BirdsHighlight the tool marks with a little paint to simulate feathers on these simple designsDearolf, Don67Summer201436wildlifepaintingfeathershttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Carving a Caricature CowboyOld-timer looks as rugged as the land he worksOlson, Ellis67Summer201438caricaturecowboyStep by Stephttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Chip-carved ToolboxBuild and embellish your own toolboxStewart, David67Summer201442chip carvingtoolboxtechniquehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Patriotic BearCelebrate the stars and stripes with a droll version of Uncle SamShipley, Mike67Summer201450caricaturewildlifepatriotichttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Carving LipsSimple techniques to carve smiling and frowning lipsEnlow, Harold67Summer201452techniquecaricaturelipshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Learn to Paint: Using Oil PaintsLearn the basics of oil painting by making a summery plaquePadden, Betty67Summer201455paintingbeginneroil paintshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Power Carving a Bark OuthouseCute carving makes a useful lavatory nightlightDe Vries, Robert67Summer201460power carvingbathroomnightlighthttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Carving a SeashellStylized hardwood shell is modeled after the real thingDonaldson, Bill67Summer201464seashellhardwoodprojectshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Cooper Hawk PortraitWoodburn (or relief carve) a striking wildlife portraitWalters, Sue67Summer201471wildliferelief carvingwoodburninghttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Genie Bottle StopperEasy-carve caricature embodies a fun play on wordsSpinak, Lawrence67Summer201472caricaturegeniebottlestopperhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Carving a FishermanCarve a curmudgeonly caricature for your favorite fishermanThornton, Dennis67Summer201474caricaturefishermangrumpyhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Shop-made Sanding DrumsMake custom rotary-tool sanders from inexpensive hardwareKinnear, Bill67Summer201484shopmadesandingtoolshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Product ReviewPorter Cable 20-volt lithium ion battery tools and Smart JarsDuncan, Bob67Summer201488Porter Cablelithium-ion battery toolsSmart Jarshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-67-summer-2014.html
Product ReviewArbotech Turboplane, Ply90 Brackets, Potato WoodDuncan, BobTomashek, Steve68Fall201414ArbotechTurboPlanePlyproductsPly90 bracketsPotato woodhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Spooky Halloween HouseAdding scenery and a sky gives a bark house a whole new lookHershey, Bob68Fall201419bark houseHalloweenlive edgehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Hand-Carving a Camping CupRustic cup is traditional, functional, and sensibleWiebe, Rick68Fall201427camping cupusefulpractical http://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Make an Old Knife New AgainCustom-grind an old folding knife into your perfect carving knifeTrier, Terry68Fall201432shopmadeknifeupcyclehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Carved Funeral CoachesBreathtaking designs honor the deceasedRyan, Kathleen68Fall201434funeralcoachesdeadhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Carve a Welcoming Wood SpiritLearn how to carve a smiling face even when the mouth isn't visibleHarrell, Millard68Fall201437wood spirittechniquesfacehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Painting the FishermanUse acrylic paints to breathe life into this angler caricatureThornton, Susan68Fall201444caricaturepaintingfishinghttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Born to CarveHailing from a family of carpenters, Michael Morris produces gorgeous cabinets and clocksRyan, Kathleen68Fall201448cabinetsclocksartist profilehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Cranky Mornings Coffee CupCreate an amusing cup for any coffee drinkerYancey, Bob68Fall201450coffee mugcaricaturepractical http://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Carving a Peach Pit PigForget spitting seeds; use them to learn a 19th-century folk artWeaver, Kivel68Fall201454peach pitseed carvingFolk Art http://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Plucky PilgrimsVersatile patterns can be flat pins or 3-D decorationsSpinak, Lawrence68Fall201456pilgrimsdecorationspinshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Low-Relief Animal ScenesUse these designs to carve gunstocks--or anything else!Irish, Lora S68Fall201460low-reliefanimalgunstockshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Learn to Paint: Using Latex PaintFor durable paint that is easy to blend, try latex house paintPadden, Betty68Fall201462paintingbeginnerlatexhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
One Ornament for Two HolidaysClever reversible ornament can be used for fall and winter seasonsStewart, Glenn68Fall201467ornamentsreversibleHalloweenhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
See-Through OrnamentsPierce these chip-carved designs to add sparkles of lightNicholas, Bruce68Fall201472pierce reliefchip carvingornamentsChristmashttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Carving Father WinterClassic Christmas figure is easy to carve and can be personalized--perfect for holiday gift-givingHendrix, Susan68Fall201475ChristmasFather Winterholiday decorationhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Sven the Happy BarkeepCelebrate Oktoberfest by carving this cute caricatureRhadigan, Floyd68Fall201478caricaturebeerGermanhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Carving a GourdNew book provides inspiration and instructionWidess, JimSummit, Ginger68Fall201482gourdscarvingbookshttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
A Different Breed of WoodworkerAllan Breed carves historically accurate reproduction furnitureRyan, Kathleen68Fall201486furnitureartist profiletechniquehttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Sweet Songbird PinPractice relief-carving techniques as you make a folk-art feathered friendJensen, Rick68Fall201488relief carvingwildlifepinhttp://www.foxchapelpublishing.com/woodcarving-illustrated-issue-68-fall-2014.html
Pyro's Cyber CuratorKathleen M. Garvey Mendenez traces the history of pyrography with her online museum Fitzgerald, ToniPYRO2014Fall201414WoodburningMuseumArtist Profilehttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Turning and Burning: The Gibsons' Cup of TeaThis husband and wife teamed up to create museum-quality teapotsRyan, KathleenPYRO2014Fall201418WoodburningArtist ProfileTea Pothttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Decorate Swirls PlateTurn a practice board into a work of artSchwartz, JoPYRO2014Fall201430WoodburningPatternTechniquehttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
The Principles of ShadingUse shading techniques to create realistic depth and dimension in your workParsons, MichelePYRO2014Fall201432WoodburningTipsCathttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
It's Not All Black and White: Tone in Pyrography Improve your pyrography by mastering the tonal scaleParsons, MichelePYRO2014Fall201435WoodburningEagleHorsehttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Creating Realistic Folds and Creases in ClothingBurn in layers to build up shadows for a lifelike lookSchwartz, JoPYRO2014Fall201438WoodburningTechniquesJackethttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Techniques for Burning on CorkLearn the tricks for turning cork into interesting pyro projectsParsons, MichelePYRO2014Fall201443WoodburningBulletin BoardOffice Decorhttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Carving with Your WoodburnerTry a new technique to create interesting gourd artWidess, JimSummit, GingerPYRO2014Fall201448WoodburningGourdsAztechttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Making Pyro Patterns (the Easy Way)Hint: You dont have to be an artist of a Photoshop whiz!Wallace, ChrisPYRO2014Fall201450WoodburningTipsPattern https://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Burning on BoneMake faux scrimshaw using a beef bone and a woodburnerWalters, SuePYRO2014Fall201452WoodburningTechniquesHorsehttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Bountiful BurningAssorted pyro patterns for inspiration and burningIrish, Lora SPYRO2014Fall201459WoodburningDeer Scenichttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Happy Fall MouseBurn and paint a delightful scene on watercolor paperSmith, DanettePYRO2014Fall201464WoodburningMouseLeafhttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Making a Spirit Animal HoopEmbellish a Native American-style ''canvas'' with inspiration animal totemsSchwartz, JoPYRO2014Fall201467WoodburningIndianPatternhttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Mirrored Display FrameCreate a custom-burned frame to complement your artworkEaston, SimonPYRO2014Fall201470WoodburningCeltic Boxhttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Animal StudiesPractice plaques makes attractive ''sampler'' artworkHajny, DesireePYRO2014Fall201475WoodburningBuffalo Bearhttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Decorative Light Switch CoverAdd a decorative touch in an unexpected placeRayyan, SheilaPYRO2014Fall201478WoodburningDragonflypractical https://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Quotable Zenspirations Designs to inspire your creativity and feed your spiritFink, JoannePYRO2014Fall201480WoodburningLive, Laugh, LoveWord Arthttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Teddy Bear AlbumCustomize a pre-made album with pyrographyCorbeil, HenriettePYRO2014Fall201484WoodburningKeepsakeFamilyhttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Creating a Pyrotangle NecklaceTurn tangles into wearable woodburned artSchwartz, JoPYRO2014Fall201488WoodburningjewelryFashionhttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Woodburning Winter Scenes Practice burning cold snowy scenes using warm sepia tonesStadtlander, RobertPYRO2014Fall201490WoodburningHouseScenichttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
Sweet Songbird PinUse a woodburner to detail a simple carvingJensen, RickPYRO2014Fall201494WoodburningBird Fashionhttps://www.foxchapelpublishing.com/pyrography-volume-4-2014.html
(Bark) Cottage IndustryRick Jensen has taught America how to cave cottages from barkDuncan, Bob69Holiday201417featuresrick jensenbark housescottonwood barkhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Moose Antler MadnessFive antler carvers transform trophies into works of artRyan, Kathleen69Holiday201433featuresmoose antlerpower carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Holiday Gift GuideFind the perfect gift for all the woodworkers on your list (including yourself!)Staff69Holiday201436featuresgift guidetoolskitsholidayshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Chip-Carved BarrettesUse Old World or Swiss-style chip carving to beautify barrettesReed, Steve69Holiday201452techniqueschip carvingbarrettesold worldswiss stylehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Learn to Paint: Using Thinned AcrylicsFor luminous translucent color, create washes by mixing paint with plain waterPadden, Betty69Holiday201476techniquesacrylic paintsexterior paintsignshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Cottonwood Bark Santa ClausCarve a rustic version of a classic designJensen, Rick69Holiday201420projectssantacottonwoodrustichttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Folk-Art Angel OrnamentPull the strings to watch the angel's wings flutterMcCaffrey, Keoma69Holiday201428projectsfolk-artangelornamentshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
''Shorty'' the Christmas ElfCheery elf brings greetings from Santa's workshopGreen, Dale69Holiday201444projectselfholidayschristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Kitten in a Mitten OrnamentPractice carving and painting purr-fect fur with this cute critterGoddard, Leah69Holiday201455projectskittenmittenornamenthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
The Spirit of ChristmasUse the natural shape of a cypress knee to create a unique Santa decorationMoore, David69Holiday201462projectssantacypress kneehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Not Your Grandmother's Holiday ElfTake a walk on the wild side with this power-carved ornamentCupp, Lundy69Holiday201471projectspower carvingelfmischievioushttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Snazzy Spiral OrnamentSpice up your Christmas tree with this large spiral bulb ornamentMorgan, Lyle69Holiday201426patternsspiralornamenthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Christmas ChainLink the letters together for a wonderful holiday decorationQuarve, Roy69Holiday201440patternschainchristmaslettershttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Christmas ReindeerA simple trick makes it easy to carve a detailed reindeerPadden, Betty69Holiday201450patternsreindeerpaintinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Angel Tree TopperComplete your tree with this gorgeous Christmas keepsakeBolyard, Janet69Holiday201460patternsangeltree topperhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Cheerful Christmas OrnamentsAdd a touch of whimsy to your tree with these easy-carve ornamentsHendrix, Susan69Holiday201468patternsornamentschristmassantasnowmanhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
Old World Santa PuzzleClever puzzle comes complete with custom storage boxHower, Carolea69Holiday201481patternspuzzlesantaold worldhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-69-holiday-2014.html
General SafetyStaffPWRCARV97Power Carving Manual vol. 119971safetydust collectionstationary systemsportable systemshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Machine TestsStaffPWRCARV97Power Carving Manual vol. 119976carving machineryface and eye protectioncarving dusthttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Flexible Shaft MachineStaffPWRCARV97Power Carving Manual vol. 119976carving machineryflexible shaft machinepfingstdremelforedomhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Micro Motor MachineStaffPWRCARV97Power Carving Manual vol. 1199718carving machinerysmc enterprisesgessweinram products, incforedomhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Air Turbine CarverStaffPWRCARV97Power Carving Manual vol. 1199727carving machineryhandpiecemaintenancereplacementhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Specialty MachinesStaffPWRCARV97Power Carving Manual vol. 1199737carving machinerycheckering machineengraving machinehttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Bit Speed and SafetyStaffPWRCARV97Power Carving Manual vol. 1199738a bit about bitsspeedsafetyhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Bit TypesStaffPWRCARV97Power Carving Manual vol. 1199740a bit about bitscarbide bursruby carversdiamond bitssteel burshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Bit AccessoriesStaffPWRCARV97Power Carving Manual vol. 1199744a bit about bitssanding mandrelsrotary brushesmandrelshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Bit Maintenance and CleaningStaffPWRCARV97Power Carving Manual vol. 1199746a bit about bitscleanerssteel bursrubydiamond bitshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Bit ShapesStaffPWRCARV97Power Carving Manual vol. 1199749a bit about bitsflameballconecylinderhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Carving AccessoriesStaffPWRCARV97Power Carving Manual vol. 1199750carving accessorieslightmagnificationmachine accessorieshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
The Basics of CarvingStaffPWRCARV97Power Carving Manual vol. 1199755how to carvestep-by-stepshapingdetailingroughinghttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Christmas Ornament (Santa Moon)StaffPWRCARV97Power Carving Manual vol. 1199760projectspower carvingsantamoonornamenthttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Walking Stick (Wizard)StaffPWRCARV97Power Carving Manual vol. 1199764projectspower carvingwizardwalking stickhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Caricature Carving (Santa Figure)StaffPWRCARV97Power Carving Manual vol. 1199767projectspower carvingcaricaturesantahttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Contemporary Primitive Waterfowl Decoy (Loon)StaffPWRCARV97Power Carving Manual vol. 1199775projectspower carvingbirddecoyloonhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Decorative Bird Carving (Cardinal)StaffPWRCARV97Power Carving Manual vol. 1199779projectspower carvingdecorativebirdcardinalhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Carving a Wizard Cypress KneeStaffPWRCARV97Power Carving Manual vol. 1199783projectspower carvingcypress kneewizardhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Floral Relief CarvingStaffPWRCARV97Power Carving Manual vol. 1199793projectspower carvingrelieffloralhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Tool ReviewThere's a power tool for you, whether it comes with a flexible shaft, has a micro-motor, or is run on compressed airPWRCARV00Power Carving Manual vol. 2200020reviewpowercarvingtoolshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Bit Chart207 bits and burs described--the most complete reference in print!PWRCARV00Power Carving Manual vol. 2200041referencebitsburspowercarvinghttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Arbortech ReviewA new tool changes the way carvers remove woodPWRCARV00Power Carving Manual vol. 2200060arbortechtoolreviewhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
An Introduction to Power CarvingLearn to use the proper tools and bits as you carve your projectsPWRCARV00Power Carving Manual vol. 2200066referencehow topower carvinghttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Timely TipsDecorate a clock with your power carverPWRCARV00Power Carving Manual vol. 2200070clockpower carvinghome decorhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Band Saw Basics for CarversEverything you need to know to use bandsaws for cutting out carving blanksPWRCARV00Power Carving Manual vol. 2200073bandsawscutting blankstipshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Power Carving a SignDavid Bennett demonstrates that power carving means time savedBennett, DavidPWRCARV00Power Carving Manual vol. 2200076powercarvingsignstep by stephttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Carving an American WoodcockFrank Russell brings to life this popular gamebirdRussell, FrankPWRCARV00Power Carving Manual vol. 2200083birdspowercarvingwoodcockhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Pattern Profile: RoosterHang your hat and coat on a unique projectKochan, JackPWRCARV00Power Carving Manual vol. 2200094patternroosterpowercarvinghttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Poor Man's ContestCash prizes go to creative carving tools and accessoriesPWRCARV00Power Carving Manual vol. 2200096contestcash prizestoolshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Relief Carving: Taking the Plunge with PowerFor relief carver Bill Judt, the router is an essential toolSchroeder, RogerPWRCARV00Power Carving Manual vol. 2200098relief carvingpowercarvingbill janneyhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Gunstock CarvingTake stock of how a master power carver decorates his firearmsJanney, BillPWRCARV00Power Carving Manual vol. 22000103gunstockcarvingpowercarvinghttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Power Texturing WoodcarvingFrank Russell studies a bird…feather by featherRussell, FrankPWRCARV00Power Carving Manual vol. 22000106techniquetexturingpowercarvinghttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Power Carving the Free and Easy WayIt's natural to use power when making realisitc antlers for game animalsSchroeder, RogerPWRCARV00Power Carving Manual vol. 22000115powercarvingwildlifeantlershttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Power Carving TipsKeep it safe, variable, and hook your power tool to an inexpensive hangerPWRCARV01Power Carving Manual vol. 3200117power carvingtoolstipshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Tool ReferenceThere's a power tool for you, whether it comes with a flexible shaft, has a micro-motor, or is run on compressed airPWRCARV01Power Carving Manual vol. 3200118referencepowercarvingtoolshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Router Table Base-icsRelief carve with one of woodworking's favorite power toolsHallaran, JoePWRCARV01Power Carving Manual vol. 3200145powercarvingrouter tablebasehttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Carving the Chief in Relief''Erasing'' wood produces a realistic pine portraitDe Angelis, PatPWRCARV01Power Carving Manual vol. 3200149powercarvingcarvechiefpatternhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Ultra-High-Speed Power CarvingStay ahead in the race with super fast rpm toolsJanney, BillPWRCARV01Power Carving Manual vol. 3200157powercarvinghigh speedsafetyhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Carve and Paint a KilldeerPower tools and a few simple colors make for a classic shorebirdKochan, JackPWRCARV01Power Carving Manual vol. 3200162powercarvingwildlifepaintingkilldeerhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Make Your Own Eye PunchesIf you're looking to save money, cast your eyes on these handy homemade toolsKochan, JackPWRCARV01Power Carving Manual vol. 3200169powercarvingeye punchesDIYhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
A Whale of a Good SculptorWick Ahrens powers up to tackle some big projectsSchroeder, RogerPWRCARV01Power Carving Manual vol. 3200170powercarvingsculptorwick ahrenshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Power Carve a Leaf PinFor starters, try a project with references right outside your windowKochan, JackPWRCARV01Power Carving Manual vol. 3200174powercarvingleaf pinbeginnerhttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Collapsible Telescoping RodHang your flexible shaft tool on Lynn Diel's well-engineered designDiel, LynnPWRCARV01Power Carving Manual vol. 3200176powercarvingtelescoping rodtoolshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Power Carve a GreyhoundEnhance a sleek breed with textureKochan, JackPWRCARV01Power Carving Manual vol. 3200180powercarvinggreyhoundstep by stephttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Maintenance on the Flexible Shaft MachineTips from an expert keep this tool running like a Rolls RoyceKochan, JackPWRCARV01Power Carving Manual vol. 3200191powercarvingmaintenanceflexible shaft machinehttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Texturing Strategies for Bird CarversImprove the realism of your next wildfowl project with instructions from Lori CorbettCorbett, LoriPWRCARV01Power Carving Manual vol. 3200198powercarvingtexturingbirdshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Which Bit is Right for You?Jack Kochan leaves no stone unturned in helping you decideKochan, JackPWRCARV01Power Carving Manual vol. 32001104powercarvingbitsburshttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
A Carver's Survival KitThe island may be deserted, but a good selection of tools is still a carver's best companionRizzo, JoePWRCARV01Power Carving Manual vol. 32001107carving toolsbasic toolspowercarvinghttps://www.foxchapelpublishing.com/power-carving-manual-updated-and-expanded-second-edition-best-of-wci.html
Artistic IllusionsRandall Rosenthal's hyper-realistic art will make you do a double takeRyan, Kathleen70Spring201520featuresrealistic carvingeverydayobjectshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Irresistible Carved CupcakesCarve these adorable cupcakes for a birthday, anniversary, or holidayProseilo, Jack70Spring201523projectscupcakesfoodhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Small Wonders Tree SpiritContemplate nature and balance as you carve this smiling spiritKrayushkin, Evgeny ''ZheKa''70Spring201526projectstree spiritreliefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Sweet Spring RabbitEasy add-ons bring this caricature to lifePlunkett, Charles70Spring201531projectscaricaturerabbithttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Power-Carved Pirate ShipIndulge your inner pirate by making a miniature Jolly RogerTyler, Ben70Spring201536patternspirate shippowercarvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Bon AppétitJim Sneary’s carvings will tickle your taste buds and spice up your lifeRyan, Kathleen70Spring201539featuresrealistic carvingfoodhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Miniature Welsh LovespoonsCarve a Valentine's Day gift in a weekendTinsley, Robert W.70Spring201542projectslovespoonswelshhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Chip-Carved CrossSimple Gothic design creates a stunning crossStrautman, Roger70Spring201546projectscrosschip carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Carving a ToadUse nails and punches to create realistic skin textureHajny, Desiree70Spring201550projectstoadpaintingtexturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Great Gouges: The Essential Tool KitA stress-free beginner's guide to choosing toolsDuncan, Bob70Spring201556featuresgougestoolshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Whittling a DogFollow the same simple steps to make any dog breedHindes, Tom70Spring201560projectswhittlingdogbreedshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Charming Church PlateCustomize this low-relief design for a church, family, or friendsBiermann, Bob70Spring201562projectsreliefchurchplatehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Whittling a Bear in a LogUse only the ''bear'' necessities to carve this fun caricatureYoung, Greg70Spring201567projectswhittlingfound woodbearhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Stylized Sea TurtleEasy power carving creates an evocative shapeDeinlein, Kathleen70Spring201570projectsturtlepower carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Grizzly BearUse this pattern to carve or burn a realistic grizzlyStiller, GordonStiller, Marsha70Spring201574patternspatternbeargrizzlyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
The Running of the BullAn angry bull charges a farmer in this wind-powered whirligigFitch, Chris70Spring201576projectswhirligigbullfarmerhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Miniature MasterpiecesCarving miniscule scenes and figures is a Jangid family traditionRyan, Kathleen70Spring201586featuresminiatureIndiancarvingshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-70-spring-2015.html
Under the SeaBill Johnson dives into chip carving to create enchanting marine lifeRyan, Kathleen71Summer201516featuresbill johnsonchip carvingmarine lifehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
The Doane Woodcarving ExperienceJoin this workshop to sharpen your carving skills, meet the top instructors in the country, and make friendsRyan, Kathleen71Summer201555featuresworkshopartist profilehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Carving Family FunLinda Langenberg Curtis's carving lessons are a legacy of love and learning for the next generationRyan, Kathleen71Summer201570featureskidsfamilyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Designing Celtic KnotworkUse simple techniques to design elaborate knotwork patternsWestern, David71Summer201534techniquescelticknotslovespoonshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Carving a Female FaceSoftness and symmetry are key for creating an attractive female caricatureStetson, Dave71Summer201558techniquescaricaturefemalehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Wild RoseBring the beauty of a summer meadow inside with this floral carvingPhillips, Charley71Summer201520projectsflowersrosehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Pirate Captain CaricatureCorner-cut a blank to bring this scurvy dog to lifeGladu, Larry71Summer201526projectscaricaturepirateornamenthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Carving Found Wooden ObjectsTurn antique tools, spools, and kitchen items into one-of-a-kind carvingsMason, Bob71Summer201530projectsfound woodrolling pinchefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Carving a CowgirlPractice—or teach—caricatures by making this cute cowpoke and her stick ponyBrown, Kristina71Summer201538projectscowgirlcaricatureornamentshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Whittling an EagleGrab a chunk of wood and a knife to carve this majestic eagleYoung, Greg71Summer201544projectswhittlingeaglehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Lady LibertyLet freedom ring with this patriotic folk-art decorationDePauw, Vernon71Summer201548projectspatrioticlady libertyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Chip Carving a Reef FishPower carve this realistically shaped fish and embellish it with chip carvingJohnson, Bill71Summer201564projectschip carvingreef fishhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Power Carving a Saw Whet OwlLearn the basics of carving a realistic bird with this owl in a simple poseParks, Hugh71Summer201573projectsowlrealistichttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Dancing JesterConvey movement and action with the pose of this comedic caricatureRhadigan, Floyd71Summer201580projectscaricaturejesterhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
Chip Carving a FlowerBreak out of the mold with this organic ornamentBarton, Wayne71Summer201543patternschip carvingflowerhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-71-summer-2015.html
The Art of Leaf CarvingTwo artists describe their techniques for turning ordinary leaves into works of artRyan, Kathleen72Fall201523featuresturningleaveshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Skeletal RemainsMaskull Lasserre resurrects old sculpturesRyan, Kathleen72Fall201551featuressculptureartist profilehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Meet DoderhultarnExploring the Swedish roots of American caricature carvingRefsal, Harley72Fall201552featurescaricatureswedishamericanhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Decrypting Thai CarvingDiscover the meaning within the motifs of Asian artworkKinsey, Mindy72Fall201565featuresasianmotifshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Getting a Handle on ItHelvie Knives is offering prizes for nifty knife handlesKinsey, Mindy72Fall201576featuresknifehandleprizeshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Learn to ''Weave'' WoodSsh, don't tell--basket-weave texture is easier than it looksPhillips, Charley72Fall201526techniquebasket-weavetexturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Straw-Stuffed ScarecrowNew technique for making straw texture is a no-brainerHiser, Jim72Fall201548techniquestrawtexturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Old World-Style Chip CarvingLearn a couple of cuts and mix 'em up to make your own ornamentsJenson, Jan72Fall201562techniquechip carvingcutshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Nuts for the HolidaysTurn a walnut shell into the setting for a miniature sceneGuay, Larry72Fall201570techniqueminiaturewalnut shellhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Getting Started with Architectural CarvingLearn to carve the three basic elements of this classical art formAllen, Mike72Fall201581techniquearchitecturalbasicshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Caricature Native AmericansMix and match elements from different carvings to create a new lookDearolf, Don72Fall201573patternscaricaturenaive americanhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Carving a PumpkinUse woodcarving tools to make the best jack o'lantern on the blockCupp, Lundy72Fall201530projectscarvingpumpkinhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Grizzy Bear BustIts small size and realistic anatomy make this desktop trophy a challengeCurtis, Kirt72Fall201535projectsbeartrophyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
New Options for Bark CottagesEnhance an existing bark house with add-on carved accessoriesJensen, Rick72Fall201542projectsbark houseaccesorieshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
The Halloween ExpressCarve add-ons to create this creepy coach & its spooky staffYoung, Greg72Fall201556projectshalloweencoachhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Thai-Inspired Relief CarvingSwirling design features symbolic motifsSmith, Steve72Fall201568projectsThailandrelief http://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Candy Corn GoblinsA sweet way to practice carving facesGeorge, Randy72Fall201578projectscarvingfaceshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-72-fall-2015.html
Cowboy SnowmanDetailed patterns & painting tips help you make a Wild West snowmanSears, Gerald and Barb 73Holiday 201524patternscowboysnowmancaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
A Chip-Carved ChristmasCreate a tree full of festive chip-carved holiday ornamentsNicholas, Bruce and Judy73Holiday 201550patternsornamentschip-carvedhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Victorian Father ChristmasA specialized finishing technique makes this carving look like a well-loved heirloomZanzalari, John73Holiday 201570techniquesfather christmasfinishinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Customize this SantaMix and match accessories or create a custom scene to personalize this Santa carving projectGreen, Dale73Holiday 201529projectsSantaChristmas scenecardinalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Whistle a Holiday TuneCute Santa carving is also a functional whistleSwartz, Don73Holiday 201537projectswhistleSantahttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
2-in-1 Heart PendantWhittle this double pendant from one piece of woodMilligan, T.J.73Holiday 201542projectspendanthearthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Santa Sampler PlateCombine chip carving and relief to create a unique holiday decorationNiggemeyer, John73Holiday 201544projectsSantaplaterelief carvingchip carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Carving a HedgehogAdorable realisitic critter can be carved in an afternoonGoddard, Leah73Holiday 201552projectshedgehogrealisticanimalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Ice Skate OrnamentAdd an unexpected embellishment to an easy power-carved ornamentMcCafffrey, Keoma73Holiday 201556projectsice skateornament christmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Chip-Carved Tea BoxA unique way to store and serve a common beverageLeenhouts, Marty73Holiday 201558projectstea boxchip-carvedhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Card Holder SantaSimple design on an oversized clothespin makes a versatile projectBorecki, Tom73Holiday 201563projectsSantacard-holderclothespinhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Nativity OrnamentsRelief-carved set tells the nativity story in four scenesBolyard, Janet73Holiday 201566projectsrelief carvingnativityornamentshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Elves in the TrenchesPay tribute to the folks who really do the work on ChristmasLeClaire, Jim73Holiday 201573projectselvescaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
Holiday Penguin OrnamentQuick and easy ornament can be carved in a few hoursYancey, Bob73Holiday 201578projectspenguinornament caricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
A Snowy Ride Carving the pieces to this scene will help while away the winter Rhadigan, Floyd73Holiday 201580projectsSantasledcaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-73-holiday-2015.html
And The Winner Is…Announcing the first winners in the 2016 People’s Choice ContestStaff74Winter/Spring201628Featurescontestwinnerhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Miniature MasterpiecesExtraordinary Renaissance carvings depict religious scenes in minuscule reliefRyan, Kathleen74Winter/Spring201636Featuresminiaturerenaissancereligioushttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Soapstone ArtistryThree sculptors share their tipsRyan, Kathleen74Winter/Spring201648Featuressoapstonetechniquehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
No Fear at 94Nonagenarian Tony Giuffrida fills retirement with creative carvingOtteson, Dean74Winter/Spring201655Featurescarvingartist profilehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Heavenly PewsCindy Chinn combines carving, glass, and light to create angelic artRyan, Kathleen74Winter/Spring201661Featuresreligiouspewsglasshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Leopard PatternReference photo, description, and detailed pattern help you carve a lifelike leopardStiller, Gordon and Marsha74Winter/Spring201646Patternsleopardanimalshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Carving a CrucifixTips for carving a religious iconChinn, Cindy74Winter/Spring201662Patternscrucifixreligioushttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Universal Bench HookGet a grip on carving projects with uneven edges DiPace, Andrew74Winter/Spring201668Toolsbenchhookhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Folk Art PeacockColorful quilt-inspired design is perfect for Mardi GrasDePauw, Vernon74Winter/Spring201616Projectspeacockquilthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Carving a North Woods Animal PuzzleEmbellish puzzle pieces with relief carving techniquesBorson, Nancy74Winter/Spring201630Projectspuzzleanimalreliefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Casual Caricature RabbitThis easy Easter bunny will be welcome in any basketGoddard, LeahRhadigan, Floyd74Winter/Spring201638Projectsrabbitcaricatureeasterhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Soapstone WhaleUse your woodcarving skills to create this stunning stone sea creatureKee, Julie74Winter/Spring201651Projectssoapstonewhalehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Big Bad WolfFierce carved wolf is a perfect accessory for days that really biteMillikan, Barbara74Winter/Spring201656Projectswolfstaplerhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Yorkie Dog CaricatureA pocket-sized pooch that’s quick to makeSmith, Sandy74Winter/Spring201664Projectsdogcaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Carving a Brook TroutUse a combination of hand and power tools to shape this realistic fishWeiss, Charles74Winter/Spring201670Projectstroutrealisticfishhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Building Noah’s ArkCarve and paint this popular childhood toyPadden, Betty74Winter/Spring201678Projectsnoaharktoyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Inlaid Bunny BoxUse liquid inlay to add intricate designs to a premade boxWolford, Roger F.74Winter/Spring201624Techniquesboxinlaidbunnyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Adding Arms to a CarvingControl the grain direction for stronger arms that are easier to carveQuist, Oren74Winter/Spring201644Techniquesarmscarvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Tips for Personalizing a ToolboxIdeas to carve, paint, and decorate your toolboxPaulson, Rev. Jim74Winter/Spring201675Techniquestoolboxpersonalizehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-74-winter-spring-2016.html
Carve an Easy OuthouseRickety outhouse is fun to carve, easy to customizeFenton, Gary75Summer201668Patternsouthousecarvehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Carving Feminine FeaturesMaster the subtle differences that allow you to carve an attractive female faceEnlow, Harold75Summer201682Techniquesfemalefacecarvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Captured MotionGerry Quotzkuyva’s Katsina carvings are like forbidden snapshots of the traditional dancesGarbers, Alan J.75Summer201620Featureskatsinamotionhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
The International Woodcarvers Congress: Half a Century of Carving ExcellenceA look at the long history of the country’s oldest carving showRyan, Kathleen75Summer201628Featurescongresshistory showhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Summer SchoolTake a fun & educational vacation at a carving school or roundupStaff75Summer201633Featuresschoolrounduphttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
And the Winner Is…More winners in the 2016 People’s Choice Contest!Staff75Summer201662Featureswinnercontesthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Spring SurpriseRealistic baby bunny is “born” from a (wooden) goose eggHajny, Desiree75Summer201622Projectsbunnyegghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Rowdy the CowboyHitch up your belt and get ready to carve this iconic Old West caricatureGreen, Dale75Summer201635Projectscowboywesthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Carve a Tea Light Holder in 60 MinutesNew high-density carves like a dream and can be finished like woodLeenhouts, Marty75Summer201641Projectstea lightchip carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Quick and Easy Brown Trout PinThe secret? Woodburn the detailsCarey, Eugene75Summer201646Projectstroutpinhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Carving a Dog WhistleProject is a clever play on a classic designSmith, Sandy75Summer201650Projectsdogwhistlehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Classic Carver's PuzzleCreate your own version of E. J. Tangerman’s classic whittler’s puzzleStewart, David75Summer201654ProjectspuzzleE.J. Tangermanhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Lazing Around with the Laid-Back FrogCarve the frog and base pieces separately and add all the accessories you wantProseilo, Jack75Summer201656Projectsfrogcaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Carving a Whimsey-filled Love SpooonChallenging pattern features three traditional carving designsAdler, Shirley75Summer201664Projectslovespoonstraditionalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Heart-in-Hand Walking StickDecorative stick has a folk-art design and a motto to live byCipa, Shawn75Summer201670Projectswalking stickheartfolkhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Carving & Painting Noah's Ark FiguresMaster the techniques of layered blanks and add-ons to carve quick and sturdy Ark inhabitantsPadden, Betty75Summer201676Projectsnoah's arkpaintinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-75-spring-summer-2016.html
Carving a Halloween SignUse a few simple tools to create a folk-art signDePauw, Vernon76Fall2016Patternshalloweensignfolkhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Jack o’PhantomEasy carved “folds” make this silly spook look like it’s floatingRhadigan, Floyd76Fall2016Patternshalloweenpumkinghosthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
On-the-Go Carving DeskQuick & easy plywood box protects your tools and contains your chipsNoller, Tom76Fall2016Patternsdeskboxhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Depth-Defying ArtRick Harney’s portraits are so much less than they appearRyan, Kathleen76Fall2016Featuresportraitsdepthharneyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Change of HeartBrian Paul Kolakowski found his third calling in woodFitzgerald, Toni76Fall2016Featuresmirrorskolakowskihttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
A Tough Nut to CrackRussian artist Arkadiy Tsesarskiy turns ugly nuts into ivory-like miniature marvelsRyan, Kathleen76Fall2016Featuresnuttsesarskyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Winning WondersMeet the winners of the third 2016 People’s Choice ContestStaff76Fall2016Featurescontestchip carvingtramp arthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Realistic LighthouseThe natural shape of cottonwood bark makes it perfect for this projectHershey, Bob76Fall2016Projectslighthousebarkrealistichttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Building a Whimsical BankForget bark: Use basswood blanks and shallow relief techniques to make a village worth visitingPowell, Bill76Fall2016Projectsbasswoodreliefbankhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Sweet TreatsThese easy-to-carve trinkets look good enough to eatProseilo, Jack76Fall2016Projectshalloweenchristmascandyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Carving a CroneUse a delicate touch with your tools to create this haunting carvingFueshko, Suzy76Fall2016Projectscronebarkhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Make a Majestic BisonUse hand tools to re-create this American iconWillis, Jim76Fall2016Projectsbisonanimalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Wise Wizard Practice PiecePick a feature and exaggerate it to enhance your skills & customize your carvingPounders, Mike76Fall2016Projectswizardpracticecaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Learning to Carve SoapGood clean fun can be the beginning of a lifelong passion for carvingMillikan, Barbara76Fall2016Projectssoapcarvingturtlehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Carving a Caricature WoodsmanTurn the head to give your carving movement and personalityFeather, Jim76Fall2016Projectscaricaturewoodsmanhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Carving a Train-in-StationLike a ball-in-cage, this captive locomotive slides on its railsSavarese, Joseph A.76Fall2016Projectstraincagehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-76-summer-fall-2016.html
Beauty AppearsArtist Juan Carlos Gonzalez says that patience is the key to pyrographyRyan, KathleenPYRO2016Fall201616WoodburningArtist ProfileScenichttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
''Why Not'' Wood BurningFay Helfer combines pyrography with natural pigments to create artwork inspired by nature, humor, science, and lighthearted randomnessRyan, KathleenPYRO2016Fall201620WoodburningArtist ProfileFairyhttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Frost in the ForestEnvironmental artist Stuart Frost uses pyrography to transform trees into towering artworksRyan, KathleenPYRO2016Fall201624WoodburningArtist ProfileTreeshttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Tinting TechniqueCombine burning, bleach, and dye to create delicate colorNoffsinger, JohnPYRO2016Fall201634WoodburningTipsSleeping Doghttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Add Realism with TextureTechniques to create the look of textures using a burnerParsons, MichelePYRO2016Fall201636WoodburningStep by StepNutshttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Making Word ArtTurn your favorite letters, quotes, and names into trendy artSmith, DanetteKinsey, MindyPYRO2016Fall201640WoodburningHome DecorInspiration https://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Hot IdeasSimple ways to use pyro in your home decorStaffPYRO2016Fall201644WoodburningHome Decorpractical https://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Making a Keepsake Basket and EggsStart an easter tradition by burning personalized eggs for your familyParsons, MichelePYRO2016Fall201648WoodburningEaster EggsBaskethttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Owl PendantDecorate this feathered friend with whimsical designsAllan, TonyaPYRO2016Fall201653WoodburningBirdPatternhttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
St. Patrick's Day Gourd OrnamentUse embossing powder to add durable color to a burned designAvery, JennPYRO2016Fall201654WoodburningGourdCloverEgghttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Whimscial Bird HousesCombine various shading techniques to portray these realistic birds and fantasy housesCorbeil, HenriettePYRO2016Fall201657WoodburningStep by StepBirdshttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Making the Most of Flawed GourdsImperfect gourds make perfect landscapes for fantasy creaturesGonzales, Ralph and MaryPYRO2016Fall201662WoodburningGourds Dragonhttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Make Your Shoes Stand OutBurn a unique design on canvas shoesParsons, MichelePYRO2016Fall201667WoodburningShoesPractical https://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Woodburning a SparrowUse a light touch to create realistic feathery textureBechtold, SharonPYRO2016Fall201672WoodburningBirdPatternhttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Country RoadsCapture the heart of America with these five tranquil scenesWallace, CarolPYRO2016Fall201674WoodburningHousePatternhttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Burning on a Walking StickAdd a personal design to this hiking necessitySchwartz, JoPYRO2016Fall201679WoodburningCanestechniquehttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Khokhloma Folk-Art PlateAdapt traditional Russian patterns for pyrographySviridova, LarisaPYRO2016Fall201680WoodburningBirdPatternhttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Woodburning a Fairy CottageCarve a simple house from cottonwood bark and embellish it with a woodburnerRussell, StevePYRO2016Fall201684WoodburningLive EdgeHouseshttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Nesting BirdsWelcome spring with caricature birdsCorbeil, HenriettePYRO2016Fall201688WoodburningBirdsFlowershttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Pyro-Tangle ClockFun, easy project lets you practice pen strokes and play with shadingSchwartz, JoPYRO2016Fall201692WoodburningStep by StepHome Decorhttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
Backyard WildlifeNature photos provide woodburning inspirationDean, KellyPYRO2016Fall201696WoodburningSquirrelButterflyHummingbirdhttps://www.foxchapelpublishing.com/pyrography-volume-5-2016.html
A Wood Carving FantasyFloyd Rhadigan is known for his quick knife, appealing fantasy characters, and tireless teaching scheduleDuncan, Bob77Winter201624Featuresrhadigancaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Carving Between the CoversItalian sculptor Nino Orlandi reveals the hidden magic in carved booksRyan, Kathleen77Winter201648Featuresorlandibookshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Carving a Place in HistoryWoodworker Barrie Casement is helping to restore St. Patrick's CathedralRyan, Kathleen77Winter201658Featuresst. patricksrestorationcassementhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Winning WondersMeet the winners of the final 2016 People's Choice ContestStaff77Winter201662Featurespeople's choicecontest2016http://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Bringing Home the TreeModel T delivers memories of Christmas pastScott, Russell77Winter201616Projectsmodel tchristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Oak Leaf TrayThis heirloom tray is as useful as it is beautifulShortell, John77Winter201632Projectsheirloom trayreliefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Block NativityStylized design makes a beautiful and durable decorationDiPace, Andrew77Winter201637Projectsnativitychristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Bright Bulb SantaCombine two Christmas classics with this clever ornamentSharp, David77Winter201678Projectssantachristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Carving a Nativity SceneAdaptable design can be displayed on your tree or mantelHower, Carolea77Winter201650Techniquesnativitychristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Simple SantaChange a few details to customize this easy carving Stetson, Dave77Winter201654Techniquessantachristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Santa VariationsCustomize your carving by sketching new accessoriesHendrix, Susan L.77Winter201674Techniquessantachristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Father ChristmasThis slightly stylized Santa will complement any holiday decorHendrix, Susan L.77Winter201621Patternschristmassantatraditionalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Casual ClausLaid-back Santa isn't checking the Naughty List this yearRhadigan, Floyd77Winter201628Patternssantachristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Frosty OrnamentThis jolly snowman won't melt after the holidaysWillis, Jim77Winter201631Patternssnowmanornamenthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Peekaboo Santa OrnamentsDon't like to carve eyes? This fast, fun Santa lets you skip 'emHower, Carolea77Winter201642Patternssantaornamentchristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Holly Napkin HolderChip carve this simple design to dress up your holiday tableLeenhouts, Marty77Winter201644Patternsnapkin holderchristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Cardinal OrnamentThis winter bird will add a splash of color to your treeWillis, Jim77Winter201647Patternscardinalornamentchristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
North Pole SnowmanSimple relief ornament can be carved and painted quicklyRussell, Steve77Winter201657Patternssnowmanornamentchristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Peace Out SantaGive Santa a retro look with this fun carvingStoddard, Rick77Winter201660Patternssantachristmasretrohttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Quick ReindeerCarve this ornament in a couple of hours and then let the kids add the colorMillikan, Barbara77Winter201664Patternsreindeerornamentchristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Hark! The Herald angels SingA choir of music legends rocks the halls of heavenThornton, Dennis and Susan77Winter201666Patternsangelchristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Carving a Caricature SoldierNew book is a heartfelt thanks to veteransRhadigan, Floyd77Winter201684Patternssoldiercaricaturehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Traditional SantaAdd or ignore details to tailor this pattern to your carving skillsWestmoreland, Thomas77Winter201688Patternssantachristmashttp://foxchapelpublishing.com/woodcarving-illustrated-issue-77-fall-holiday-2016.html
Delicate ArtistryNairi Safaryan uses an indescribable technique to create utterly unique artRyan, Kathleen78Spring201724Featuressculptureegghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
High Relief, High FantasyA lifelong fan of fantasy novels, Randy Stoner tries to capture the tales in woodStoner, Randy78Spring201743Featuresfantasyreliefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Building a Carver's FrameShop-made holding fixture allows you to carve anything outdoorsBeam, Ralph78Spring201773Patternsframecarvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Perpetual CalendarCustomize this project with chip- and relief-carved embellishmentsMeisel, Paul and Dipace, Andrew78Spring201780Patternsreliefcalendarchip carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Creative Projects from Coloring BooksThe coloring fad has a side benefit: the designs are great for woodworking, too!Kinsey, Mindy78Spring201746Techniquescoloringpatternshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Carving a Dragonfly Print BlockUse thie relief carving for printmaking or decorationHibberd, Andy78Spring201750Techniquesdragonflyprintingreliefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Practice Carving FacesPractice two expressions on one face with this funny figureStallings, Dennis78Spring201776Techniquescaricaturefacehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Carving a Low-Relief PortratLearn how to use a photo as a pattern to carve a portraitThompson, Graham78Spring201786Techniquesportraitlincolnreliefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
A Chip-Carved Optical IllusionA clever geometrical design and careful carving make this flat plate look 3-DJohnson, Bill78Spring201718Projectsplatechip carvingillusionhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Carving a Panda CubUse a woodburner to add fast and easy texture to this cute critterGoddard, Leah78Spring201728Projectspyrographypandawoodburninghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Folk-Art Chess SetCustomize the colors and details to create a chess set you'll be proud to play and displayDePauw, Vernon78Spring201734Projectschessfolk arthttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Pastry CrimperDecorative and functional kitchen tool will help you make heavenly piesBloomquist, Mike78Spring201754Projectscrimpertoolkitchenhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Noah's Ark Relief SceneSkip roughing out by using a precut wooden blank to carve this silly sceneDickie, Lori78Spring201760Projectsnoaheggreliefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Finding Beauty in Scrap WoodTurn a long, narow blank into a keepsake roseMillikan, Barbara78Spring201763Projectsscraproseflowerhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Elephant Hanging HookComical Carving is also a functional hangerHershey, Bob78Spring201768Projectselephanthookhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-78-spring-2017.html
Hooked on TraditionFive generations of carvers create memories makeing fishing decoysRyan, Kathleen79Summer201726Featuresfishingdecoyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Flying HighRealistic shapes and colors turn fan birds into fantastic artwordRyan, Kathleen79Summer201750Featuresfanbirdshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Fairy-Tale FrogCaricature creature is easy to customizeHershey, Bob79Summer201719Patternsfrogcaricatureanimalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Stir Crazy!Use paint sticks to make versatile chip-carved craftsLeenhouts, Marty79Summer201722Patternschip carvingstickshttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Americana WhaleThis folk-art style carving is a craft-show favoriteDePauw, Vernon79Summer201752Patternswhalefolk artanimalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Creating Weathered WoodPower carve a better branch than Mother Nature makesClark, Butch79Summer201728Techniquesbranchpower carvingrealistichttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Understanding Chip-Carving DesignsCompare two chip-carving designs to determine your preferencesBarton, Wayne79Summer201734Techniquesmirrorschip carvinghttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Woodburning Animal EyesCreative techniques to portray soulful eyesHoffman, Aline79Summer201786Techniqueswoodburningpyrographyanimalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Cypress Knee Fairy HousesCypress knees are better than cottonwood for whimsical found-wood carvingsBorecki, Tom79Summer201716Projectscypressfairywhimsicalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Sliding Ball-in-CageEmbellis a wooden dowel with an unusual whimsy designLeFave, Ed79Summer201737Projectswhimsyball-in-cagehttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Carving a MuskyMake a life-size muskellunge or scale it down to fit your decor. Power carving makes it easy!Weiss, Charles79Summer201740Projectsrealistic power carvingfishhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Making Wooden Measuring SpoonsCarve this functional project from a single block of woodNiggemeyer, John79Summer201746Projectsmeasuring spoonspracticalhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Oak Leaf Picture FrameOutdoor-themed frame teaches you the basics of relief-carving layersSmith, Steve79Summer201754Projectsframeleavesreliefhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Custom WhistlesCreate a cool collectible by adding a carved topper to a wooden whistleArnett, Don79Summer201759Projectswhistletoyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Carving a Daisy PinFloral pin is a perfect gift for Mother's DayStewart, Glenn79Summer201764Projectsdaisyflowerpinhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Quick WizardSimple project is perfect for teaching beginners or just fun for yourselfKozakiewicz, Bob79Summer201766Projectswizardbeginnerhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Early Bird AutomatonAdd life to a vivid Mexican folk art-style carving with a simple mechanismNapoli, Frank79Summer201769Projectsfolk artautomatontoyhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Carving the Sea CaptainUse realistic anatomy to bring this classic carving project to lifeGoodson, Dylan79Summer201774Projectsrealisticsea captainhttp://foxchapelpublishing.com/woodcarving-illustrated-issue-79-summer-2017.html
Woodcarver of the YearMeet Janet Cordell, the 2017 honoreeRyan, Kathleen80Fall201716Featureswoodcarver of the yearwcotyJanet Cordellhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Distinctively Different DecoysChris Boone uses natural bark, knots, and lichen to accent his carvingsRyan, Kathleen80Fall201726FeaturesdecoyduckChris Boonehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Blades and BanjosCarver Barry Sholder strikes a chord with gourd banjosRyan, Kathleen80Fall201768Featuresbanjocarvinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Make a House SignVersatile design is easy to carve and suits any homeLeenhouts, Marty80Fall201732Techniquessignchip carvinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Pattern Making with Clay ModelsIf you don't draw as well as you'd like, make your pattern from clayHiser, Jim80Fall201736Techniquesclaypatternmodelhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Creating a Carving from a Kid's SketchTransorm your child's art into a carvingMotovidlak, Jill80Fall201765Techniquesdrawingsketchhalloweenhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
High-Relief Carving Made EasySimple technique gives expert resultsPadden, Betty80Fall201720Projectssunflowerpumpkinreliefhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Carving a Relief LandscapeCreate miles of depth in a 2''-thick blankGoodson, Dylan80Fall201742Projectslandscapereliefbarnhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Halloween Puzzle PlaysetFreestanding figures fit into haunted house box for storageHower, Carolea80Fall201748ProjectsHalloweenpuzzleplaysethttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Trick or Treat WitchFocus on the expression while making this amusing witchPounders, Mike80Fall201760ProjectswitchHalloweencaricaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Tiny T. rexKing of the lizards will be a hit with dino lovers of all agesAltison, Brian80Fall201770Projectsdinosaurpower carvinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Bighorn RamCreate this realistic animal bust with just five toolsGoddard, Leah80Fall201776Projectsrampower carvinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Standing Blue HeronCarve and paint a tranquil relief sceneStadtlander, Robert80Fall201784Projectsheronbirdreliefhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Carving a Red-Tailed Hawk Walking StickSimple pattern creates a stunning walking stickStehly, David80Fall201728Patternswalking stickbirdhawkhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Burning a Fall Scene on LeatherUse colored pencils to bring this autumn scene to lifeSmith, Danette80Fall201730PatternspyrographywoodburningAutumn / Fallhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Carving a Boy ScoutThis iconic figure is easy to customizeHammack, Chris80Fall201753Patternsboy scoutcaricaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Custom Paint RackSize this basic design to fit your workspaceRussell, Steve80Fall201756Patternspaint rackorganizehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Dual OrnamentDisplay this quick-carve ornament from autumn to ChristmasHower, Carolea80Fall201758PatternsornamentsAutumnChristmashttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-80-fall-2017.html
Shelf Santa SitterDetail this simple smiling face by piercing through the beardBeane, Roger81Winter2017ProjectsChristmasSantahttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Tree of Life Oil LampUse a woodburner to turn a gourd into a functional lampHundt-Brown, Karen81Winter2017ProjectsAutumngourdhttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Carving a Custom BraceletUse power tools to create heirloom-quality jewelry quickly. Plus! Add a unique metal inlay in 4 easy stepsDean, Tom81Winter2017Techniquescoppergifthttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Carving a Realistic SantaTips & tricks for carving your most lifelike St. NickGoodson, Dylan81Winter2017ProjectsChristmasrealistichttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Happy Tree OrnamentQuick-carve holiday gift allows you to experiment with making different facesGreen, Larry81Winter2017PatternsChristmasBob Rossornamenthttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Carving a Christmas Cigar BoxUpcycle a classic wooden box with a holiday designHajny, Desiree81Winter2017ProjectsChristmassnowmanlow reliefhttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Santa SpoonsTransform inexpensive kitchen utensils into unique holiday decorationHower, Carolea81Winter2017PatternsChristmasfound woodhttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Relief-Carved SnowmanEasy painting technique highlights carved textureIrish, Lora81Winter2017ProjectsChristmasSnowmanhttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Monogram Knotwork PlaqueSwap out the letters to customize this plaque for someone specialJohnson, Clayton81Winter2017Patternscelticornamenthttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Chip-Carved Snowflake OrnamentsMix and match designs to create dozens of easy ornamentsMacKay, Gary81Winter2017PatternsChristmas ornamentschip carvedsnowflakehttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Jingle Santa OrnamentCut-n-carve ornaments are easy to make for everyone on your listNelson, Jon81Winter2017PatternsChristmasreliefornamenthttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Carving a Storybook OrnamentUse an easy layering technique to create a high-relief scenePadden, Betty81Winter2017ProjectsChristmaslayeredornamenthttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Carving a Sports-Themed PuzzleLow-relief tray puzzle makes a great giftReid, Kevin81Winter2017Projectslow reliefpuzzlesports https://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Labor of LoveClayton Johnson wants to make the world a better place one carving at a timeRyan, Kathleen81Winter2017Featurekitchendecoratingceltichttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Woodchips: Snow SnakesBismarck N.D.Ryan, Kathleen81Winter2017Featuresnow snakesschoolnative americanhttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Carving Santa and RudolfYour new chance to carve our very first SantaSabol, David81Winter2017PatternsChristmasReindeercaricaturehttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Woodchips: An Angel in HandTed BreedRyan, Kathleen81Winter2017Featureseniorartist profileangelhttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Dragon WandPower-carve found wood into a fantasy treasureSeevers, Tamera81Winter2017Projectsmagicharry potterdragonhttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Reversible Santa & Snowman OrnamentOrnament shows a different scene on either sideStewart, Glenn81Winter2017ProjectsChristmasscenicornamenthttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Santa Tee OrnamentTransform an ordinary golf tee into a tiny ornamentTrue, Randy81Winter2017ProjectsChristmasgolfornamenthttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
How Sweet It IsJoin us as we celebrate the magazine’s two decades in the carving community—and look forward to many more!Kinsey, Mindy81Winter2017Featureanniversaryinfographictimelinehttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Painting a Basket of FlowersDetailed painting instructions help you complete your realistic relief carvingPadden, Betty81Winter2017ProjectsAutumn / Fallpaintingoil painttechniquehttps://foxchapelpublishing.com/woodcarving-illustrated-issue-81-winter-2017.html
Handmade with LoveHandcarved cookie molds have been used to make edible artwork for more than 700 yearsRyan, Kathleen82Spring201830Featurecookie moldsreliefhistory
Carving Cookie MoldsUse scrap wood to make quick carvings that you'll use for yearsMcCafffrey, Keoma82Spring201834ProjectsreliefDremel, power carveEaster, spring
2017 International Woodcarvers CongressA look at the top winners and a few of our favorite carvings from the country's top carving competitionFeatherly, Marc82Spring201860Featuresconvention52nd Affiliated Wood Carvers
Carver Sticks to ScripturesRon Vance makes his walking sticks meaningful by carving them with gospel messagesRyan, Kathleen 82Spring201874FeaturesBibleX-Acto, disposable bladeetchingpastor
Recommended Beginner ToolsYour snap guide to the tools you need to get started carvingDuncan, Bob82Spring201876Featuresdetail bladePfeil, Helvie, Flexcut, Pakel, Magrid, WarrenglovesX-Acto, disposable
Holding TightlyCustomize this easy-carve design to make a gift for your Valentine or any special eventScott, Russell82Spring201826Patternshuman figuresV-toolroughoutsheart
Stylized DancerElegant design highlights a no-fail way to create depth without wasting woodMillikan, Barbara82Spring201864PatternslayeringV-toolhuman figureornament
Cribbage Board Rosette CarvingLearn to carve a classic design by decorating a plate or game boardLeenhouts, Marty82Spring201822Projectschip carvingembellishmentdrillingpower carving
Dancing Hearts Wood BurningPair simple burning with easy painting for a pretty spring pyro projectPompano, Deborah82Spring201837Projectsbleeding heart flowerswood burningspring
Power Carve Your First BirdSimple pose, shading, and feather structure make the Carolina wren a perfect first bird projectConner, Randy82Spring201842Projectsanimalspringrotary tool woodburning
Carving a Welcome SignSimple system for carving letters like an expert. Plus! Learn how to apply gold leafDepauw, Vernon82Spring201850Projectspineapplechip carvinghome decor
Folding CrossUse a disposabe blade and a series of strategic cuts to create a symbol of the seasonVance, Ron82Spring201871ProjectsX-ActoEasterspringChristianitywhittling
Carving the Female FaceDetailed instructions teach proportions and explain techniques for creating an attractive portraitHoward, Chris82Spring201880Projectswomanbustblack walnutdiamond bitin-the-round
Creating Realistic Fur TextureThis caricature bunny blends realism with whimsy, making it the perfect project for practicing fur techniquesHershey, Bob82Spring201818TechniquesrabbitEastergardeninganimalwoodburning
Creating a Custom Blade CoverIngenious leather sheath turns any blank into a blade coverBeane, Roger82Spring201855Techniquescaricature headssafetygouging routerwhittling
Creating Natural Pigment PaintsLearn to make and use paints from the pages of historyGerbers, Alan82Spring201858TechniquescolorHopi, Arizona, ancientmineralshistory
Carving Realistic HandsStep-by-step instructions will help you carve expressive, lifelike handsGoodson, Dylan 82Spring201866Techniqueshuman bodygouging fingersskew chisel
Art...Pure and SimpleInspired by the outdoors, John Houle uses natural elements to create portraits of the world around himRyan, KathleenPYRO2018Spring201814WoodburningArtist ProfileWildlifehttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Technicolor DreamsMerideth Berthiaume breaks all the rules to create works saturated in color and detailsRyan, KathleenPYRO2018Spring201818WoodburningArtist ProfileFairyhttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Achieving a Burning AmbitionAn impossible idea can sometimes result in something awesome. Pyrography helped it happen for meEaston, SimonPYRO2018Spring201822WoodburningArtist ProfileBoxhttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Beautiful Butterfly Practice GourdExperiment with shapes, texture, and shading while you make a ''gourd''geous spring projectAvery, JennPYRO2018Spring201831WoodburningGourdButterflyhttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Burning Fur TextureFive tricks for making perfect fur on your animal portraitsRobinson, MinisaPYRO2018Spring201836WoodburningSquirrelStep by Stephttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
7 Super Simple Shading TechniquesMaster these methods and you'll be able to shade any projectParsons, MichelePYRO2018Spring201840WoodburningCelticRosehttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Coloring Your PyrographyAdding a splash of color can help a project popHundt-Brown, KarenPYRO2018Spring201844WoodburningButterflyColored Pencilshttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Learning LettersMonograms and messages are hot trends. Turn them into pyro projects with these two easy techniquesSchwartz, JoPYRO2018Spring201847WoodburningWord ArtPatternhttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
How to Fight FadingPyro projects fade over time. Or do they? Learning what's going on and what to do about itIrish, LoraPYRO2018Spring201850WoodburningChurchTipshttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Hair!Once you learn the basic technique, it's easy to burn any texture, style, or 'doSchwartz, JoPYRO2018Spring201852WoodburningWomanStep by Stephttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Burning BuildingsLearn to burn common construction materials, and then combine them in an easy rustic sceneIrish, LoraPYRO2018Spring201856WoodburningMillScenichttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Making a Paper FanGet ready for warmer weather—and practice your water and cloud techniques—with this beach-themed projectParsons, MichelePYRO2018Spring201860WoodburningDolphinsStep by Stephttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Mushroom Doodle BoardUse playful patterns to create a unique garden sceneIrish, LoraPYRO2018Spring201864WoodburningMushroomsPatternshttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Burning the Birds & BeesA surprise method helps balance the intense burning and lush color of this gorgeous paper projectMcCauley, CatePYRO2018Spring201870WoodburningFloralPatternhttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Home Sweet Home PlaqueCombine a sepia burn with delicate watercolor to create a dreamy garden scenePompano, DeborahPYRO2018Spring201876WoodburningHome DecorLatticehttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Penguin EmbraceMake a charming gift any parent will appreciateRobey, SusanPYRO2018Spring201883WoodburningEggFamilyhttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Hatching a HorseUse an old-school shading method to create a faux engravingIrish, LoraPYRO2018Spring201886WoodburningChessieHorsehttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Sunny Flower BoxPractice basic techniques while you make a great Mother's Day giftSchwartz, JoPYRO2018Spring201890WoodburningWord ArtKeepsakehttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Burning ''Mona Lynxa''Using shading, not outlines, to create the sly smile and sleek fur of this wild catRobinson, MinisaPYRO2018Spring201895WoodburningLynxAnimalshttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Easy TagsUse your woodburner to make everyday objects a little more specialSchwartz, JoPYRO2018Spring201874WoodburningHome DecorPracticalhttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Green Man on LeatherSupple leather is an ideal surface for burning this traditional icon of nature Irish, LoraPYRO2018Spring201880WoodburningForestFacehttps://www.foxchapelpublishing.com/pyrography-volume-6-2018.html
Carving a Cottonwood Bark ChainChoosing a different type of wood makes it easier to join the ''chain gang''Wiebe, RickWHITSIP2018Whittling Vol. 5201836Quick & Easyanchornauticaloceanhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Carving a Spoon Without a Hook Knife This surprisingly elegant rough-hewn spoon proves you can create curves by carving straight lines Mac, Jon WHITSIP2018Whittling Vol. 5201886Weekend Projectsutensilspracticalcamping foodhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Updating the Ball-in-Cage Rounded edges give this traditional favorite a fresh new look Egholm, Frank WHITSIP2018Whittling Vol. 5201892Weekend Projectsovalchainwhimsyhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Ball-in-a-BallCarve this new take on a classic whimsey Randich, Keith WHITSIP2018Whittling Vol. 5201894Weekend Projectssimplestocking-stuffergifthttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
10-Minute Dogs This pattern is fast and easy—and adaptable to any breedHindes, Tom WHITSIP2018Whittling Vol. 5201818Beginning Carverscanineflat-planeScottiehttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Best-Ever Blade Cover A simple trick ensures this cover stays in place to protect your blade Fenton, Gary WHITSIP2018Whittling Vol. 5201820Beginning Carversmagnetflat-planesafetyhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
A Skulk of Foxes This family of foxes fits together to form a puzzle, game, or finger fidgetDawson, HeathWHITSIP2018Whittling Vol. 5201822Beginning Carvers bushcraftchildrenfunhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Luring You OnLearn to carve with the grain by making a fishing lureRefsal, Harley WHITSIP2018Whittling Vol. 5201824Beginning Carvers oceancolored sportfishhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Stick Horses and Other Twig Animals Turn a twig into a pen or a back scratcher with just a few cuts Lubkemann, ChrisWHITSIP2018Whittling Vol. 5201831Beginning Carverssimplepracticalbarnyard creatureshttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Carving a Big Cat Make a black panther or a jaguar using the same pattern Self, Don WHITSIP2018Whittling Vol. 5201834Beginning Carvers profileanimalfelinepaintedhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Hatching a HedgehogComfort critters are easy to make with basswood eggs and a simple template Kulp, Steve WHITSIP2018Whittling Vol. 5201842Quick & Easytherapy animalssimpleeasyhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Whittle a Baby Elephant This elephant in the room is too cute to ignore Hindes, Tom WHITSIP2018Whittling Vol. 5201840Quick & Easycircuspachydermpaintedhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
One-Twig Owls Once you get the hang of it, you'll be carving these ''owl'' day long Lubkemann, Chris WHITSIP2018Whittling Vol. 5201846Quick & EasyanimalsnocturnalHarry Potterhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Quick & Easy Football Player Start with a premade basswood shape so you can get to the fun part faster Dickie, Lori WHITSIP2018Whittling Vol. 5201849Quick & Easysportscaricaturefootballhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Super Simple Santa This jolly ornament is so easy you'll be making dozens in no time flat Overby, John WHITSIP2018Whittling Vol. 5201850Weekend ProjectsSt. NickChristmasholidaywinterhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Making a Grumpy Soap Man Hone your carving skills with this sweet-smelling beginner projectMorgan, Chris WHITSIP2018Whittling Vol. 5201853Weekend Projectscaricaturebeginnersoap carvinghumorhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Doggone Cute Pugs Combine flat-plane carving with painted details to create canines with characterMiller, JamesWHITSIP2018Whittling Vol. 5201856Weekend Projectsdogsanimalspainted https://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Smooth Fox Whittle and sand your own streamlined comfort animal Benson, PeterWHITSIP2018Whittling Vol. 5201860Weekend Projectstherapy animalssandedbeginnerhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Angelic Ornament Carve and finish this beautiful stylized design in an afternoonSchauer, DouglasWHITSIP2018Whittling Vol. 5201876Weekend ProjectsChristmasholidaywinterreligioushttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Whittle Dwarfs Tiny cartoon carvings are perfect for practicing expressionsMertz, Don WHITSIP2018Whittling Vol. 5201864Weekend Projectsfantasycaricaturehumorhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Whittling an Eagle Grab a chunk of wood and a knife to carve this majestic eagle Young, GregWHITSIP2018Whittling Vol. 5201868Weekend Projectsanimalbirddecorationhttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Simple SongbirdUse this all-in-one pattern to carve and paint your favorite backyard birdEgholm, Frank WHITSIP2018Whittling Vol. 5201872Weekend Projectsanimalbird-watchingcollectionsrealistichttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Carving a Caricature CopThis adorable officer is so easy it should be illegalRefsal, Harley WHIPSIP2018Whittling Vol. 5201874Weekend Projectscaricaturepolicemanpainted simplehttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Twig Squirrels You'll go nuts for the curly tails on these cute crittersLubkemann, ChrisWHITSIP2018Whittling Vol. 5201879Weekend Projectsanimalmammalforesthttps://www.foxchapelpublishing.com/whittling-volume-5-2018.html
Power Carving Basics Get started with tools you can find almost anywhereDuncan, Bob84Fall2018Featuresproductsworkshop tools
Tools for Removing Wood Quickly We test-drive the hardiest ''toys'' on the market Duncan, Bob84Fall2018Featuresproductspower carving workshop
Taming the Spanish Bull Fierce fighting maching is a bull's-eye project for advanced carvers Stiller, Gordon and Marsha84Fall2018Patterns animal realistic sport
Fall Cardinal Scene This vivid pyro project proves that autumn is the perfect season to burn Pompano, Deborah84Fall2018Patterns pyrographyautumnanimalbird
Versatile Chip-Carved Borders Use or modify these basic borders to embellish a variety of projects Leenhouts, Marty84Fall2018Techniqueschip carving DIYhome decor
Creating a Stone Effect Simple technique to make any carving look like stone Irish, Lora84Fall2018Techniques painting finishing tips
A Family of Owls These watchul egg owls are a hoot to hold and to make Kulp, Steve 84Fall 2018Projects animalsbeginnerbird
Golden Eagle Walking Stick Dress up a functional cane with this glorious raptor Purnell, Paul84Fall2018Projectspower carving animalsbird realistic
Just Chillin' What does the dragon do after destroying the castle? This carving tells the untold tale Napoli, Frank84Fall2018Projectsanimalsfantasymedieval caricature
Making a Bark Church Use tree bark to carve a realistic church complete with cross and steeple Mayer, Andy 84Fall2018Projectscottonwood barkrealistic religious
Scourge of the Seven Seas Transform a simple turned egg into a not-so-dashing swashbucklerAkers, Mark 84Fall2018Projects pirateknife holderfunctionalworkshop
Boo! Pumpkin Light up your house with this friendly painted spook Padden, Betty84Fall2018Projectspaintfinishing technique Halloween
Frank the Sweet Greeter This fun and functional relief carving will have trick-or-treaters in stitches Bolyard, Janet 84Fall2018ProjectsHalloweenautumnkidsspooky
Fall Scene in Low Relief Create a festival of color and texture with this rustic landscape Stenman, Fred and Elaine 84Fall2018Projectsautumn farmoutdoorsanimals
Carving a Raccoon Fur texture and a sneaky grin complete the ensemble for this backyard bandit Hajny, Desiree 84Fall 2018Projects realisticwood burning paintedanimals
Jam Spreader Carve this simple utensil just in time for breakfast Muire, Celina 84Fall2018Projectskitchenbeginnerknife
Two-Sided Ornaments Practice your low-relief carving on these cheery holiday decorations Hower, Carolea84Fall2018ProjectsThanksgivingChristmaswinterrelief carving
Jolly Old SoulReimagine the classic Santa carving with this whimsical caricature elfGosnell, Dwayne 85Winter201821PatternscaricatureChristmasholidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Pear-Shaped SantaTurned blank allows you to carve without worrying about symmetry and proportions Beane, Roger85Winter 201824PatternscaricatureChristmasholidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Peppermint-Stick St. Nick Bold hues and a sky-high hat make this Santa stand out in a crowd Francis, Dave85Winter201830PatternsstylizedChristmasholidaycaricaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Carve & Burn Bird Ornaments Add life to a tree or window with these bright avian adornments Parsons, Michele 85Winter 201852Patternspyrographyanimalsholidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Nostalgic Snowman Ornaments Use a simple faux finish to give these characters an old-timey look Motovidlak, Jill85Winter201854PatternsChristmasholidayrelief carving https://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Chip-Carved Coasters Dress up functional discs with a geometric old-world design Jenson, Jan 85Winter 201867PatternsstylizedChristmasholidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Frolicsome FawnBambi's got nothing on this frolicsome prince of the forestHajny, Desiree85Winter201875Patterns animalsrealistic holidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Curly-Haired Kris Kringle Santa's got a brand new perm! Refine your texturing skills with this unique ornament Akers, Mark 85Winter 201826Projects caricatureornamentholidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Dancing Santa After Christmas, he gets his groove back! Shinlever, Wayne 85Winter201832ProjectscaricatureholidayChristmashttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Circle of Love Nativity Stylized scene evokes the emotion that bonds the Holy Family together MacKnee, Chuck 85Winter 201845Projects stylizedscroll sawdecorationholidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Fisherman Ornament Charming design will have all your loved ones clamoring for their very own ''grumpy'' sailor Kozakiewicz, Bob85Winter201856Projectscaricatureoceanbeachhttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Ball-in-Cage Snowman With a glowing pipe and a carrot nose, this classic whimsey has never looked so charming Zanauskas, Pete85Winter 201860Projects holidaycaricaturewhittlinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Quick and Easy Standing Angel Carve and paint a stylized seraph with an inspiring story Lang, Don 85Winter201864ProjectsholidayreligiousChristmasdecoration https://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Comfort Penguins A special ingredient makes these tuxedoed birds as sleek as the real thingMellott, Tom 85Winter 201870Projects paintedholidayanimalscomfort animalshttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Carving a Rolling Pin Santa Use a reciprocating carver to give old utensils a new face George, Randy 85Winter201881Projectskitchenpower carving holidayrelief carvinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Painting Santa OrnamentsA road map for the color-wary carver Leavy, Carol 85Winter 201840Techniquesholidaycaricatureacrylicshttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Get Started Spoon Carving We hand-make our food—why not our utensils? Use a pro's tips for successIrish, Lora85Winter201885Techniqueskitchenbeginner carvingchip carvinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Betty Padden's Carved Christmas Spectacular This enchanted village has so many amazing details, you'll forget it's a tree stand Schofield, Kaylee 85Winter 201848Featuresholidaypaintingcarvinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Introduction to Reciprocating CarversBlend an edged-tool texture with the speed of a power carver Duncan, Bob85Winter 201878Featurespower carving workshop productshttps://www.foxchapelpublishing.com/woodcarving-illustrated-85-winter-2018.html
Put to the Test: Walnut Hollow Creative Woodburner New design is sleek and powerful—and won't break the bankIrish, Lora86Spring 201918Featuresproduct reviewpyrographywoodburninghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Maine's Master Craftsman New England carver John Bryan gives old tools—and some unique wood—a new lease on life Schofield, Kaylee 86Spring 201948Featuresrelief carvingarchitecturechisels hand carving https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Sophie Takes a Selfie This comical caricature suggests that the smart phone craze isn't just for humans anymore Napoli, Frank86Spring 201931Patterns elephantanimalsfunnyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Carving a Realistic Rabbit Turn this woodland favorite into an adorable spring decoration Hajny, Desiree86Spring 201941Patterns animals woodburningEasterbunnyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Power Carving a Bear Head Make this handsome beast without endless hours of fur texturing Andrews, Lori 86Spring 201925Projects animalsrealistic cane-topper https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Landing a Largemouth Bass You won't need to fish for compliments with this impressive trophy Weiss, Charles86Spring 201935Projectsanimalsfishingrealistichttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Get Whale Soon! Brighten up a friend's sickbed with this caricature cetacean Bloomquist, Mike86Spring 201943Projectsanimalsfunnypaintedhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
A Flashing School of Fish Catch the fluid motion of these permit in a bas-relief Bryan, John86Spring 201950Projects relief carvinganimalsfishing https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Creature of the Night Craft an owl pendant in an afternoon Assumma, Massimo 86Spring 201956Projects animalsbirdsjewelrystylizedhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Windy the Cowboy Classic caricature designed to be easy to carve Hammack, Chris 86Spring 201959ProjectsfunnyWild Westcowboyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Wizard's Book of Spells This enchanted tome is ready for a shelf at Hogwarts McDonald, Jean 86Spring 201963Projectsmagicspellbookpaintedhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Chip-Carved Picture Frame Display photos (and your artistic talent) in one elegant project Leenhouts, Marty86Spring 201968Projects chip carvingdecorationfunctionalusefulhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Floral Bracelets Add carved charms to commercial jewelry for a one-of-a-kind gift McCafffrey, Keoma86Spring 201973Projects charm braceletbotanical plants https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Embellish a Walking Stick Adorn your favorite staff with a Celtic-inspired braided handle Allard, John 86Spring 201977ProjectsSt. Patrick's Daypyrographycanehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Using Reciprocating Carvers How to carve projects fast and easily with these powerful tools Deck, JonDuncan, Bob 86Spring 201980Techniquestipstools & shopknifehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
Selecting a Carving Knife It all comes down to fit and steel quality Irish, Lora86Spring 201986Techniques tipstools & shopknifehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-86-spring-2019.html
A Dream Saw for Rough-OutsThe New Pégas Scroll Band Saw removes more wood from blanks faster and easierDuncan, Bob87Summer201921Featuresproducttools & shopscroll sawhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Spotlight: Roman & Olga RepikovaFrom foraged wood to handcrafted finishes and tools, this couple takes ''made with love'' to a new levelSchofield, Kaylee 87Summer201947Featureschip carvingetsyartist profilehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Spotlight: Frank NapoliThis carver gets inspiration from daydreams, PBS shows, and Dr. SeussSchofield, Kaylee 87Summer201980Featurescaricatureanimalsfunnyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Summery Supernova CoastersMinimalistic chip carving design is chic and perfect for beginnersChernikov, Roman 87Summer201939Patternschip carvingcoastersminimalistusefulhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Stylized Wooden CombsLove your locks with a look to beat the barberRepikova, Roman and Olga87Summer201948Patternschp carvingcombusefulhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Classic Bark Green ManDancing eyes and an oak-leaf mustache add character to this woodland spiritOvercash, Kathy87Summer201926ProjectsGreen manfantasytreeleaveshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Greedy Bear CubTaste sweet success with this cute caricature in just eight stepsGosnell, Dwayne 87Summer201935Projectscaricatureanimalsbearhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Northern Shoveler Hen Walking StickWant a realistic bird you can carry everywhere? This piece fits the billPurnell, Paul87Summer201941Projectsbirdrealistic walking stickhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Wood Spirit in CottonwoodThis pensive forest guardian is a perfect intro to carving the human faceLaCasse, Alec87Summer201951Projectswood spiritrealistic treehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Carved & Burned Feather EarringsDecorate your lobes with a pair of nature-inspired baublesHundt-Brown, Karen87Summer201956Projectswoodburningjewelryfeathernaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Cute & Easy Caricature PigThis carved version of Wilbur is definitely ''some pig''Shinlever, Wayne 87Summer201959Projectscaricatureanimalspighttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Baby Chickadeea little bird told us this is the perfect summer project for power carversClark, Butch87Summer201969Projectscaricaturebirdpower carvinganimalshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Civil War Soldier BustsFocus on the face in these classic caricaturesAkers, Mark 87Summer201974Projectscaricaturehistorybottle stoppersCivil Warhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
I Prefer BrieA humorous pairing of details makes this unlikely gourmand a project to rememberNapoli, Frank87Summer201982Projectscaricatureanimalsfunnyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Carving Classic MoldingDress up a building, box, or frame with these elegant designsAllen, Mike87Summer201965Techniquesmoldingclassic egg & darthttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-87-summer-2019.html
Choosing a Whittling KnifeWhat to look for when selecting a folding knifeDuncan, BobWHITSIP2019Whittling Vol. 620196Starter Guidetoolshttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
The Basics of SharpeningProperly prepare your knife for safe and enjoyable whittlingDuncan, BobWHITSIP2019Whittling Vol. 620198Starter Guidetoolssafetyhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Whittling SafetyA few simple rules to prevent injuriesDuncan, BobWHITSIP2019Whittling Vol. 6201910Starter Guidesafetytoolshttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Basic Knife Cuts for WhittlingComplete most projects with four types of cutsDuncan, BobWHITSIP2019Whittling Vol. 6201911Starter Guidesafetytoolsknifehttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Teaching Kids to WhittleSimple suggestions make it fun and easyKinsey, MindyWHITSIP2019Whittling Vol. 6201912Starter Guidebeginnerchildrenhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Woodsy BearLearning to whittle a simple soap bear can lead to a lifetime of pleasureBolyard, Janet WHITSIP2019Whittling Vol. 6201913Starter Guidebeginnerchildrensoap carvinghttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Man in the MoonClever carving uses just a knife and a scrap of basswoodStetson, Dave WHITSIP2019Whittling Vol. 6201921Beginning Carverscaricaturemoonbeginnerhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Twisted Spiral OrnamentWhittle this seemingly complex design in just eight stepsKent, CarolWHITSIP2019Whittling Vol. 6201924Beginning Carversspiraltwistedornamenthttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
10-Minute DogsThis pattern is fast and easy—and adaptable to any breedHindes, Tom WHITSIP2019Whittling Vol. 6201927Beginning Carversdogsflat planeanimalhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Whimmy DiddleTurn a stick or two into an entertaining toyLubkemann, ChrisWHITSIP2019Whittling Vol. 6201929Beginning Carverstoystickswhittlehttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Whittling a Tiny HippoPractice carving animal caricatures with this amusing miniatureTomashek, SteveWHITSIP2019Whittling Vol. 6201931Beginning Carvershippocaricature animaltinyhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Simple SantaSpread holiday cheer with this basic designSchuck, KathleenWHITSIP2019Whittling Vol. 6201934Beginning CarversSantaChristmaswhittlehttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Slip-Bark Whistle This kid favorite is quick, easy, and really really loudThomas-Price, Andrew WHITSIP2019Whittling Vol. 6201996Beginning CarversStickwhistletoychildrenhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Celtic KnotworkSimple design can be a brooch, pendant, or ornamentWestern, DaveWHITSIP2019Whittling Vol. 6201937Quick & Easycelticdesignknothttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Bark Pine TreesUse cottonwood bark scraps to create whimsical pine tree magnetsElswit, BetsyWHITSIP2019Whittling Vol. 6201939Quick & Easybarktreesnaturehttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Caricature SnowmanStart your holiday early with this fun designYoung, GregWHITSIP2019Whittling Vol. 6201941Quick & Easysnowmancaricature winterholidayhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Letter OpenerFour simple steps to a long-lasting toolLubkemann, ChrisWHITSIP2019Whittling Vol. 6201943Quick & Easyletter openertoolsstickhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
5-Minute WizardBeginner project is a great introduction to woodcarvingHindes, Tom WHITSIP2019Whittling Vol. 6201945Quick & Easywizardfantasymagichttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Whittling a NuthatchUse a utility knife to carve a charming folk art birdCutts, GlynWHITSIP2019Whittling Vol. 6201949Quick & Easybirdnaturerealistic nuthatchhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Wilma WitchWhittle a wacky witch from a basswood Santa blankDickie, Lori WHITSIP2019Whittling Vol. 6201953Quick & EasyHalloweenholidayfantasywitchhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Cottonwood Bark ChainChoosing a different type of wood makes it easier to join the ''chain gang''Wiebe, RickWHITSIP2019Whittling Vol. 6201957Weekend Projectschaincottonwoodanchorhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Whittling Java JohnUse large flat planes to emphasize exaggerated featuresRefsal, Harley WHITSIP2019Whittling Vol. 6201961Weekend Projectscaricatureflat planescandinavianhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
A Family of Owls These watchul egg owls are a hoot to hold and to make Kulp, Steve WHITSIP2019Whittling Vol. 6201967Weekend Projectsanimalseggsowlshttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Classic Ball-in-CageThis old-time whittling project is a real attention-grabberDussinger, Addison ''Dusty''WHITSIP2019Whittling Vol. 6201970Weekend Projectsball-in-cagespiralwhimseyhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Americana Eagle Walking StickFolk art hiking stick inspired by historic carvings. PLUS: Harvesting blanks for walking sticks (page 78)Cipa, ShawnWHITSIP2019Whittling Vol. 6201973Weekend Projectswalking stickfolk arthikingeaglehttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Whittle a Spoon Without a Hook KnifeThis surprisingly elegant rough-hewn spoon proves you can create curves by carving straight lines Mac, Jon WHITSIP2019Whittling Vol. 6201981Weekend Projectsspoontoolswhittlehttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Branch RoosterTurn a twig into a classic carvingLubkemann, ChrisWHITSIP2019Whittling Vol. 6201986Weekend Projectsroostertwigbranchtinyhttps://www.foxchapelpublishing.com/whittling-volume-6-2019.html
Sunken TreasureA team hunts underwater for some very special woodSchofield, Kaylee 88Fall201970Featuresinker woodbayoucypresshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Working with Sinker WoodExperts evaluate Blue Bayou cypress for various projectsStaff 88Fall201972Featureproduct reviewbayou cypresshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Autumn JewelryPower carve a lovely array of wearable acorns and leavesMcCafffrey, Keoma88Fall201935Patternjewelryleavesacornshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Chip-Carved Ball-Foot BoxLayered leaf and wave patterns evoke a breezy afternoon in the woodsLeenhouts, Marty88Fall201945Patternchip carvingboxleafhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Pickin' and Grinnin'Fur, grass, cloth, wood--try out a multitude of textures on this cheeky beaverHershey, Bob88Fall201923Projectscaricatureanimalbeaverhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Making a MobiusThis eye-catching design will make you want to do the twistBorecki, Tom88Fall201931Projectssculpturestylizedmobiushttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Cat and Moon Pendant Practice hand carving hardwood with this friendly feline charmAssumma, Massimo 88Fall201937Projectsjewelrycatmoonanimalhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Power Carving a Golden RetrieverWhile away the dog days on this noble canine projectAndrews, Lori 88Fall201940Projectspower carving doganimalhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Jack the PumpkinYou won't need a fairy godmother to bring this gourd to lifeGreen, Larry88Fall201949Projectscaricaturehalloweenjack-o'-lanternhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Old World Halloween OrnamentsCarve a rustic jack-o'-lantern and a not-so-creepy kittyMotovidlak, Jill88Fall201953Projectshalloweencatpumpkincaricaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Making a MummyUse a micro tool to awaken this cheerful keeper of the crypt Cartledge, Mitch88Fall201957Projectshalloweenmummycaricaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Whittle a Wily Witch PinNo need for toil and trouble on this simple flat-plane hag!Hindes, Tom 88Fall201961Projects halloweenwitchpinwhittlinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Count DraculaHone your carving and painting skills on this toothy troublemakerGosnell, Dwayne 88Fall201965Projectshalloweencaricature vampiredraculahttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Burning the RavenLearn to create feather and stone textures with this Poe-worthy portraitConnell, Valarie88Fall201974Projectshalloweenravenpyrographyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Classic Oak Leaf FrameThis practical (and pretty) pierced design is a walk in the parkFortune, Mark88Fall201980Projectspicture frameleavesoak leafhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Customize a Fan BearShow your favorite sports nuts they're #1 with personalized caricaturesOwens, Eric 88Fall201985Projectscaricatureanimalsportsbearhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-88-fall-2019.html
Spotlight: Kevin KaminskiThis artist fell in love with spoons at a chili party; we check in with him 3,000 utensils laterSchofield, Kaylee 89Winter201971Featuresspoonsspoon carvingartist profilehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
WOO-ing Women WoodworkersWorkshops created by and for women are popping up all overSchagrin, Danielle89Winter201984Featureswomen woodworkerswoodcutsprintmakinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Should You Add a Lathe to Your Shop?Turn this tool into a useful carving companionSchofield, Kaylee 89Winter201988Featurestools and shoplatheturninghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Chip-Carved SledsSlide into winter with these clean, geometric decorationsLynum, Charlene89Winter201930Patternschip-carvingornamentsholidayChristmashttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Hand Plane WoodcutMake an artistic print of a classic tool of the tradeTantillo, Renee89Winter201986Patternswoodcuthand toolsprintmakinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Bethlehem StarTop your tree with this stellar chip-carved designLeenhouts, Marty89Winter201996Patternschip-carvingChristmasholidaystarhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Santa's Little HelpersThe winter holidays are for the birds--just ask St. Nick!Cipa, Shawn89Winter201923ProjectsSantafolk artanimalsholidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Fireman SantaThis jolly elf has gone undercover to put our fires--and keep you off his naughty listScott, Russell89Winter 201932ProjectsSantafiremanholidayChristmashttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Relief-Carved Snowman & SantaA friendly competition between carvers shows just how versatile a blank can beBeane, RogerRussell, Steve89Winter201939ProjectsSantaSnowmanholidayChristmashttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Simple Chimney SantaTry out your whittling skills on a little project with a big personalityKozakiewicz, Bob89Winter201942ProjectsSantacaricature Christmasornamenthttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Scottish St. NickSanta dons a matching kilt and cap for his holiday in the HighlandsSwartz, Don 89Winter201945ProjectsSantaScottishTartanChristmashttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Burned and Painted Nativity OrnamentsCrisp lines and vivid colors make for a stirring four-part manger sceneHower, Carolea89Winter201951ProjectspyrographyChristmasornamentnativityhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Flate-Plane ReindeerGive your tree some vintage flair with this easy-carve ornamentFerguson, Brian89Winter201960Projectsflat-planeChristmasornamentanimalhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Plucky PenguinsCarve a colony of flightless birds--with just one knife!Barraclough, Sara89Winter201963Projectscaricaturewhittling animalwinterhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Norbert the ElfCarving Santa's head watchmaker will take no time at all!Kozakiewicz, Bob89Winter201967ProjectscaricatureElfChristmasornamenthttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Making a Walnut ScoopHosting a holiday dinner? This stylish utensil is the perfect serving toolKaminski, Kevin89Winter201974Projectsspoonsspoon carvingwalnuthttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Carving a Rosette AppliquéThis floral motif has roots in ancient architectureKennedy, Robert89Winter201979Projectsrosetteappliquéclassicalhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-89-winter-2019.html
Making an Insect CondoProtect pollinators using common materials from around the yard and shopKaylee Schofield90Spring202044Featuresnatureinsectsbeeshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Airbrushing on the CheapYou could have two-thirds of an air-brush setup hiding in your workshop!Jon Deck90Spring202067Featurespaintingbudgettipshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
The Key Marco CatThe tools used to carve this ancient figurine might surprise youKaylee Schofield90Spring202089Featuresartifactanimalarchaeologycarving https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Chip-Carved Gothic CrossSee the contrasting design appear with each new cut!Marty Leenhouts90Spring202029Patternsholidayreligious crosshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Mythical Woodland Cottage: Part 1Carve layers of pine to make a cozy home for a literary creatureBetty Padden 90Spring202078Techniquescaricaturehobbit housecottagefantasyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Love You Beary MuchThis charming beast won't steal your honey, but she may steal your heartSara Barraclough 90Spring202020Projectscaricaturevalentineanimalbearhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Simple Fork & Spoon SetAdd milk paint to hardwood utensils to make carved details popElizabeth Sherman 90Spring202025Projectsmilk paintutensilskitchenhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Hangry HawkCarve this sassy caricature in an afternoon - with just one little block of wood Dennis Thornton 90Spring202031Projectscaricaturebirdanimalhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Painting the Hangry HawkPractice blending, drybrushing, and lining techniques on this small but expressive carvingSusan Thorton 90Spring202036Projectscaricaturepaintingrealistic animal https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Hummingbird Moth GourdTransform a treasured photo into a piece of pyrography artJenn Avery 90Spring202040Projectspyrographyhummingburdpottergardenhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Trefoil Rosette AppliquéSpruce up household furniture with a timeless floral motif Mark Ivan Fortune 90Spring202046Projectsflowerstep by stepreliefhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Carving a Baby DragonHatch this charming creature from a tiny basswood blockJim Feather 90Spring202051Projectscaricatureanimalcreaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Simple Holiday HousesCustomize this cottage blank for Easter, Christmas, and HalloweenAaron MayerAndy Mayer 90Spring202057Projectsholidayhousecarvinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Comfort TurtleCarve a simple 8-step reptile using just two toolsTom Mellott 90Spring202060Projectshand-heldanimalanxietyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Flat-Plane BunnyThis rascally rabbit is as cute as the real thing, but won't destroy your vegetable patchJames Miller 90Spring202063Projectsrabbitanimalnaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Minnow ChaserPractice your airbrushing skills on this realistic lureRich Rousseau 90Spring202069Projectsair-brushfishinglurehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Whittled Cocktail StirrersSpice up party beverages with these reusable picksTom Hindes 90Spring202075Projectsholidayparty ideasdrinkshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
Woodchips: Swedish Courting SpoonSwap out the cheesy Valentine card for a 17th-century alternative Dave Western 90Spring202096Projectsswedishromancespoonshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-90-spring-2020.html
The Scoop on SpoonesaurusEmmet Van Driesche and Matt White use Instagram to bring the spoon carving community closer togetherDanielle Schagrin91Summer202032Featuresspoon carving Instagramfeaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
5 Spoon Carving ToolsHandy products for the entire process, from roughing out to finishing touchesJon Deck91Summer202034Featurestoolsspoon carvinggougeskniveshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Spotlight: Amy CostelloChip carver finds balance in complex designs Hannah Rachel Carroll91Summer202055Featureschip carverAmy Makes EverythingSalt Lake Cityhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Skater DudeThis gnarly caricature comes with his own built-in helmetRick Stoddard91Summer202058Techniquesskateboardcaricaturekid-friendlyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Carving a Lace Trompe l'oeilCarve delicate details like a pro using one simple techniqueJulien Feller91Summer202076Techniquescarving delicate lace https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Woodspirit in Cottonwood BarkCarve a gorgeous female face in short orderAlec LaCasse 91Summer202021Projectsbarkrealisticfemalehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Sunflower Weave WoodburningCelebrate the dog days of summer with this bright, homey designJo Schwartz91Summer202027Projectswoodburning flowerssummerhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Carving a Pocket SpoonThis versatile utensil lets you eat on the go with elegance and easeEmmet Van Driesche91Summer202036Projectsspoon carving utensilsrustichttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Patriotic SantaGear up for Election Day with a candidate everyone can agree onBob Kozakiewicz91Summer202040ProjectsUSAUncle SamSantacaricaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Flat-Plane AlligatorBuild up layers of texture on this mean, green swamp creatureJames Miller91Summer202045Projectsanimals gatorflat planehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Elegant Floral Relief Capture the fleeting beauty of a daylily in hardwood Rosanna Coyne91Summer202049Projectsflowerrealistichardwooddaylilyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Making a Chip Carved BowlEmbellish turned objects with this clever repeating designAmy Costello91Summer202056Projectschip carving kitchen turned https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Hatching a Comfort Turtle from an EggKeep worries at bay with these calming creaturesSteven Kulp91Summer202066Projectsbasswood egganimals masking techniquehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Mythical Woodland Cottage: Part 2Blend rich paint hues to finish this gorgeous pastoral paradiseBetty Padden91Summer202069Projectshobbit housepainting whimscial https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Easy-Carve GiraffeMastering this gentle giant with put you head and shoulders above the rest Tom Hindes91Summer202080Projectsanimals whittlebeginnerhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Realistic Yellow-Rumped WarblerLearn to power carve and paint every feather on this exquisite songbirdRandy Conner91Summer202083Projectsbirdpower carve bird carvehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
Wonky Whittled LadybugsBring a bit of Mother Nature indoors with these colorful carved bugsTim Thompson91Summer202096Projectsinsectswhittlebugshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-91-summer-2020.html
5 Under 35Meet five rising stars in woodcarving Hannah Carroll92Fall202018Featurescarving artistsyoung new carvershttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Carving Down Under Germaine Keys doesn’t just carve birds—she carves tiny cartoon birds in fanciful boats Kaylee Schofield92Fall202040FeaturesbirdsGermaine KeysAustralia https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Paintbrush Care for CarversLearn to select, clean, and store your brushes like a proBetty Padden92Fall202055Featuresbetty paddenpaintbrusheshow tohttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
So You Want to Teach Wood Carving?Heed these helpful pointers as you plan your first class Tom Hindes92Fall202084Featureshow to Tom Hindesteachtipshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Woodchips: Off the ChainTraveling chainsaw artist brings extreme carving to the masses Hannah Carroll92Fall202096FeaturesGriffon Ramseychainsaw carvertattooshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Chip Carved Phone HolderThe Digital Age meets Old World style in this sweet celebration of autumnCharlene Lynum92Fall202057Patterns cell phone chip carve patterns practical https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Friendly Gnome Carve a cute, classic character with a twistSara Barraclough92Fall202024Projectsgnomecaricaturecarving Sara Barraclough https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Stylized Sugar Spoon Add elegance to your breakfast ritual with this simple hardwood tool Saskia De Jager92Fall202029Projectshandcarved kitchen spoon carvinghttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Acanthus Leaf JewelryWhy let buildings and furniture have all the fun? Turn an ancient design motif into wearable artMary May92Fall202032Projectsjewelry ancientmotif https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Bird in a BoatThis cheery little seafarer will brighten your day in an instant Germaine Keys92Fall202043Projectsbirdscaricaturecutecolorful https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Light-Up GhostCarve and paint a glowing ghoul that’s all treats, no tricks Betty Padden92Fall202051Projectsghosthalloweentrick-or-treatghoulhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Noble BisonPractice flat-plane carving techniques on this mighty lord of the prairie James Miller92Fall202060Projects animals flat-planein-the-roundhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Carving a Pumpkin Girl Bring this cute and quirky jack-o’-lantern to life in Alex Joiner92Fall202065Projectshalloweenpumpkinstrick-or-treatfallhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Vampire Skull Bottle StopperSink your teeth into this practical, skill-building projectRandy George92Fall202069Projectswine vampirehalloweenscaryhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Power Carved Lion BustFeel like the king of beasts with this realistic walking stick toppePaul Purnell92Fall202073ProjectsAfricalionwalking stickcanehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Mouse and Pumpkin PinThis plucky critter is a great intro to carving and paintingWayne Laramore92Fall202081Projects brooch pinhalloweenfallhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
A Ball Within a BallTransform a golf ball into a sports lover’s new favorite keepsakeRick Stoddard92Fall202037Projectsgolf ballsports beginner projectsoccerhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Leather Bookmark Use woodburning to embellish a classic gift for bookwormsMichele Parsons92Fall202047Projectsleatherpyrographyreading https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Woodsy Bear & TreeLearning to whittle a simple soap creature can lead to a lifetime of pleasureJanet Bolyard92Fall202086Projectssoapwhittlebeginner projectkid-friendly https://www.foxchapelpublishing.com/woodcarving-illustrated-issue-92-fall-2020.html
Extreme BurningThese artists push the boundaries on what it means to play with fireHannah CarrollPYRO2020Fall202016Featurestorchmagnifiying glassfractal https://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Gourd PreparationGet your gourds ready for burning in a few simple stepsLora S. IrishPYRO2020Fall202088Featuresgourdburninghow togourd arthttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Embers: Getting InkedFor pyrographer Andy Mills, tattooing and woodburning go hand in handHannah CarrollPYRO2020Fall2020112Featurespyrographytattootattoo artcedarwood artshttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Autumn KaleidoscopeFrom fiery leaves to turkey tail mushrooms, this forest scene has more color than a carnivalDeborah PompanoPYRO2020Fall202047Patternsfallleavesbirdsbeginner https://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Beginner Practice PatternsNew to burning? Test these simple designs on everything from spoons to jewelryLora S. IrishPYRO2020Fall202055Patternsbeginner hennapatternssimple designshttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Dragonfly Soleil GourdUse gold leaf to highlight the details on this elusive insectJenn AveryPYRO2020Fall202033Techniquesdragonflygourdgourd artsummer projectshttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Burning the NoseUse contour lines and shading to burn a realistic facial featureJo SchwartzPYRO2020Fall202042Techniquesnosespyrographyhuman facesrealistic https://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Woodburning a Dinner SceneLearn to “burn glass” in an elegant tableau fit for royaltyMinisa RobinsonPYRO2020Fall202049Techniquesadvancedpatterns glassgrapeshttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Leather Key FobPractice simple shading and coloring techniques on this nostalgic designMichele ParsonsPYRO2020Fall202057Techniquesleatherpyrographyhow topracticalhttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Pyrography Portraits from Pet PhotosCreate personalized woodburnings of cats, dogs, hamsters, and more using these winning tipsLora S. IrishPYRO2020Fall202060Techniquesportraitspyrographypetsanimalshttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Trio of BloomsUse negative space to frame and flesh out three elegant botanicalsMarsha WilsonPYRO2020Fall202066Techniquesflowersbotanicalsnegative spacepyrographyhttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Creating Scale TextureThis fiery dragon scene brings a whole new meaning to the phrase “burned artwork”Don StephensonPYRO2020Fall202070Techniquesdragonsfiregame of thronesmythicalhttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Great Horned OwlLet this stern flier keep watch over your domain Valarie ConnellPYRO2020Fall202074Techniquesowlbirdsfeathertexturehttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Castle Cookie JarStore your sweets in a medieval fortress worthy of King ArthurSi EastonPYRO2020Fall202081Techniquescookieskitchen containerbrickshttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Burning SmokeMake a powerful steam train using just one tipMinisa RobinsonPYRO2020Fall2020103Techniquestrainlocomotivesmokesteamhttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Mountain LionBurn a fierce face of the forest in just nine steps Minisa RobinsonPYRO2020Fall202027Projectswildcatmountain lionjungleanimalshttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Stylized PeonyPractice making fluid lines on a bold, elegant summer blossomShannon MahoneyPYRO2020Fall202038Projectspeonyflowerssummerbotanicals https://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Henna GourdTransform an ordinary gourd into a mesmerizing piece of art with simple swirls and shapesMary McConnellPYRO2020Fall202092Projectsgourd arthennabeginnergourds https://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
Dream Catcher ClockRepeating designs let you burn a practical gift in record timeSi EastonPYRO2020Fall202097ProjectsclockNative Americanbeginner projecthttps://www.foxchapelpublishing.com/pyrography-magazine-volume-7-2020.html
The Tiny MenagerieSteve Tomashek's fun miniatures explores one-knife carving on a whole new scaleKaylee Schofield93Winter202072Featureswhittledanimals Germanywoodworkerhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
The Chocolate GeniusThis artist uses ingenuity and high-quality chocolate to sculpt epic showpiecesHannah Carroll93Winter202096Featureschocolate carversculptingFood Networkhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Chip Carved Perpetual CalendarStart the New Year right with a freestanding calendar the whole family will loveMarty Leenhouts93Winter202030Patternschip carvercalendarNYEhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Lantern SantaWant to add some movement to your caricatures? Let St. Nick light your way Floyd Rhadigan93Winter202057PatternsSantaClauscaricatureholidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Classic Bell OrnamentsLearn to chip carve with this trio of timeless decorationsCharlene Lynum93Winter202063Patternschristmas tree bellsholidaygiftshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Saucer Sled SantaCarving this giddy Claus is as enjoyable as a holiday in the AlpsRussell Scott93Winter202023ProjectsSantasleddingholidaycaricaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Simple SnowmanTurn a piece of scrap wood into a wintry whittled classic Kristoffer Hoyum93Winter202035Projectsfrostywhittle classicholidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Flat-Plane ReindeerPractice curved cuts and long facets to create this docile prancerJames Miller93Winter202038ProjectsSvenFrozen Rudolph holidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Winter Hiker Get a taste of the mountains with this easy-carve adventurer Peter Jofs93Winter202048ProjectsAlaska Eskimoparka caricaturehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Christmas ElfCarve one of Santa’s helpers in just nine short stepsDwayne Gosnell93Winter202053ProjectsChess SetChristmasSanta's HelpersHolidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Peppermint PenguinJoin this cute caricature for the candy cane caper of a lifetimeMatt Kincade93Winter202065ProjectsNorth Poleanimals caricaturenaughtyhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Tiny Bird Ornament Whittle a scrap wood flier as small as your thumbnail Steve Tomashek93Winter202074Projectsminiaturewhittledbirdacornhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Frostbite SantaChill out and make some woodchips with this grumpy beginner projectBob Kozakiewicz93Winter202077ProjectscaricaturegrumpySantano eyeshttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Winter Solstice TomteDon your comfiest sweater, stir up some cocoa, and make a charming character straight from ScandinaviaBetty Padden93Winter202084ProjectsSantaheadcaricatureholidayhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Layered Relief Ornament Stack three separate pieces to create a nostalgic scene full of depth and detailBetty Padden93Winter202043Techniqueschristmaschurchornamentreliefhttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Pinecone OrnamentThis whittled wonder of the forest is a great way to get to know your woodgrainBob Kozakiewicz93Winter202060Techniquesforestchristmaswoodlandwhittlehttps://www.foxchapelpublishing.com/woodcarving-illustrated-issue-93-winter-2020.html
Carving a Running HorseSpeed up the carving process (and save your hands and arms) with powerAndrews, Lori 94Spring202153Techniqueshorsepower carve drill bitsanimalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Celtic Birds of FriendshipMany tiny dots bring this classic pyrography design to lifeIrish, Lora94Spring202163Techniquespyrographybirdsirish stampshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Ruby-Throated HummingbirdCarve and texture this feather-light flier with a rotary toolCzajka, Sandy94Spring202185Techniquespower carving realisticmigratory birdshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Chip Carving Butterfly PlateAdorn a simple disc with repeating symbols of springLynum, Charlene94Spring202140Patternschip carving home decor decorative wheat https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Easy-Carve HoneybeeLet this sweet little big remind you to stop and smell the rosesBarraclough, Sara94Spring202127Projectsbeebugsinsectscaricaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Carving & Painting a Striped BassBeaten copper fins take this realistic fishing trophy to the next levelAltison, Brian94Spring202132Projectsfishingrealistictrophy fishsporthttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Salad ServersWith these spoons around, your family recipes won't be the only talking point at dinnerTremblay, Brad94Spring202137Projectsspoon carving practicalhome decorrustic https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Carved TattoosMark Mother's Day or Father's Day with a totally unique gift they'll recognize right awayWells, Len94Spring202143Projectsgiftsmomdadmagnetshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Butch the Shelf-SitterThis Wild West wrangler will add charm to any book nookAkers, Mark94Spring202149Projectscowboywild westcaricaturebandana https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Stylized GnomeCarve and color a signature piece fit for a fairytale Czeladka, Miroslaw94Spring202160Projectsnochalki gnomesbeginner-friendlyWEB extras https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Chip Carved Cross Pendant Add elegance to your ensemble this Easter with a classic symbol of hopeAssumma, Massimo 94Spring202167ProjectsEasterreligious jewelry fashion https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Flat-Plane SheepAdd dryburshing to make this farm animal appear even fluffierMiller, James94Spring202169Projectsanimalscaricaturestep-by-stepfarmhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Comfort WhaleCalm your inner storms with a 5-step project straight from literatureMellott, Tom 94Spring202177Projectsnautical animalMoby Dick comfort animal https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Carving a Flower Garland in MahoganyPractice undercutting and adding details on this simple yet effective relief Fox, Lucy94Spring 202180Projectsrelief carvingflowersspring designhome decor https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Orin the Patchwork LeprechaunCelebrate St. Patty's Day with this not-so-lucky beginner caricature Kozakiewicz, Bob94Spring202189ProjectsIrishSt. Patrick's Daycaricaturelucky charmshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Carving for the SuperheroesThanks to Johnathon Whittaker, more than 300 plaques have been donated to hospitals in the UK94Spring202114FeaturesUKCOVIDhospitalplaques https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
The Smile FactoryThai carver Parn Aniwat has a simple recipe for reigniting your childhood joySchofield, Kaylee94Spring202174FeaturesDragonsMoonbirdColorfulcaricatureshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-94-spring-2021
Creature of HabitFor this nun, woodcarving and religious vocation go hand in hand Carroll, Hannah95Summer202118FeaturesCatholicReligious woodcarverspiritualhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Dust Collection Roundup Consider these options for keeping your woodshop— and lungs—free of dustDeck, Jon95Summer202122Featuressawdustwoodshopcleanup healthhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Pencil Me InGifted graphite carver makes minuscule sculptures using an X-Acto blade and a microscope Schofield, Kaylee95Summer202150Featuressculpturesmicroscopicwoodcarvingtinyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Blast Off!This three-part carve will make you want to suit up for space travel Stoddard, Rick 95Summer202141Techniques rocketouter spacescience fictionwoodcarvingastronauthttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Realistic Tropical FishPower carve a butterfly fish as vibrant as its namesake Spencer, James95Summer202161Techniques power carving animals beachnautical https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Friendly Field MouseDon’t let its size fool you! This little rodent packs a punch Padden, Betty95Summer202129ProjectsanimalsSpringstep-by-stepsunflowerhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Circle of ChipsAlternate two striking chip types in this summery, modern wall hangingBernat Mercader95Summer202136Projectschip carving home decor decorative geometricmodernhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Matchbox Aquarium Carve a little fish habitat using minimal materials and tools Steve Tomashek95Summer202146Projectsdioramaminature nauticalwhittlinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Whittled UnicornComplete this petite project in just seven steps Lieve Roelants95Summer202152Projectsanimalssimplebeginnermagicalfairytalehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Simple Scallop ShellPractice undercutting and line work on this elegant reliefLucy Fox95Summer202155Projectsrelief carving seashellsbeachbeginnerhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Chip Carved EarringsA soothing aloe leaf pattern gives these statement pieces a natural touchAmy Costello95Summer202159Projectschip carving jewelrygiftsnaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Three-Point Ribbon Create a classic wooden whimsy with just a Dremel and a knife Garth Burgon 95Summer202166Projectswhimsicalcraftsbeginnersimplepower carvinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Classic Bread BowlDetail this stylish vessel with milk paint and sand the facets for a rustic finishLuke Voytas95Summer202169Projectskitchenhome decor decorative turninghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Fearless FreddieA hungry shark is no match for this beach-bound frogBob Hershey95Summer202173Projectssurfingbeachcolorfulamphibiananimalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Chip Carved Jewelry BoxAdorn a standard container with this dynamic sunburst Tatiana Baldina 95Summer202180Projectschip carvingjewelrysunburstgiftsadvancedhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Volute Ladle Add sophistication to your table with a spoon fit for the symphony Mark Ivan Fortune95Summer202185Projectskitchen utensilscookingdecorative violinmusichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Stylized SharksWhittle two classic ocean predators in one sitting Tom Hindes95Summer202190Projects whittlingoceansummertimebeachJawshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-95-summer-2021
Keeping the Tradition AliveMāori woodcarver ‘Broxh’ levels up his craft onlineHannah Carroll 96Fall202120FeaturestraditiongamingonlineTwitchmaorihttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Product Review: MakerX® Rotary Tool & Airbrush ComboUnique power hub gives you the freedom to craft wood wherever the open road takes youStaff96Fall 202122Featurespower carving toolsairbrushportablehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Storytelling With WoodNikki Reese carves everything from fishermen and gnomes to classic video game tropes—and crafts wild bios for them allKaylee Schofield96Fall202152Featuresgnomesmythical creaturescaricatures magical fishermenhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Comfortable CarvingPractice these simple stretches to enjoy carving for long periods of timeDon Swartz96Fall202188Featurescomfort exercisesstretches posturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Carving a Viking Drinking CupThis dragon-shaped drinking vessel is fit for a fairy taleJon Mac96Fall202176Techniquesdrinking cupdragonvikingfairytalehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Twig & Leaf Drawer HandleAdd woodland flair to drawers and doors with this one-of-a-kind embellishmentRobert Kennedy96Fall202181Techniquesdrawersdoor handleleaftwigwoodlandhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Sea CaptainUse the rich tones of cottonwood bark to highlight this weathered sailor’s featuresAlec LaCasse96Fall202127Projectscaptainsailorcottonwoodbarkhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Spooky Jack-O’-Lantern CaricatureThis expressive pumpkin is ready for Fright NightMatt Kincade96Fall202133ProjectspumpkinsHalloween caricaturejack-o'-lanternspumpkin carvinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Power-Carved Barn Owl ChicksShape, sand, and texture these baby birds of prey Paul Purnell96Fall202140Projectspower carving barn owlsbirds of preywoodlandhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Simple Scarecrow PinMake a fashion statement this fall with a classic three-step broochWayne Laramore96Fall2021 45Projectsscarecrowautumnjewlerybeginner friendlyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Wendy the Shelf-Sitter WitchThis charming carve is sure to light up your favorite ledge, desk, or book nookRichard Embling96Fall 2021 47ProjectsHalloweenwitchpuppetdecorbeginner friendlyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Tiny Gnome HomeTurn basswood scraps into clever little cottagesNikki Reese96Fall202154Projectsgnomescottageminaturesimplemythical https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Grumpy Lil' ManThis walnut-sized carve has a whole lot of attitudeKaren Scalin96Fall202157Projectslittlecaricaturemidgetgrumpydwarfhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Mr. Chanticleer the RoosterDeck out this folk art fowl with bright colors and playful patternsLarry Green96Fall202167Projectsfolk artroostercaricaturebeginner friendlyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Little Pilgrim With a splash of paint and just a few tools, you can add this classic character to your harvest collectionAlex Joiner96Fall202171Projectspilgrim caricatureThanksgiving harvestMayflowerhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Trick-or-Treater CaricatureTransform a basswood turning into an adorable work of art Lori Dickie96Fall202185ProjectsHalloweencaricaturekids caricaturetrick-or-treathttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Gridiron GusRush into fall with this game-winning football caricatureFloyd Rhadigan96Fall202137PatternsfootballautumncaricatureFriday nightssportshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Spooky SantaThis costumed Kris Kringle mixes two favorite holidays into one fun pieceDave Francis96Fall202162PatternsHalloweenSantaChristmascaricaturepumpkinshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Classic Swirl RosetteGet comfortable carving three-corner chips with this elegant repeating designMarty Leenhouts96Fall202165Patternschip carving swirlscoastershome decor https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-96-fall-2021
Basic Knife Cuts Learn the four type of cuts to take on any future projectStaffWHITSIP2021Fall20216Starter Guidetoolsknifebasicbeginner friendlyhttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Whittling SafetyHeed these simple rules to prevent injuriesStaffWHITSIP2021Fall20218Starter Guidewhittlingknifesafetytoolshttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Knife Selection Follow these tips when selecting a folding knifeStaffWHITSIP2021Fall202110Starter Guideknifetoolswhittlingshop toolshttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
The Basics of SharpeningProperly prepare your knife for safe and enjoyable whittlingStaffWHITSIP2021Fall202112Starter Guidesafetyknifetoolsmaintenanceknife sharpeninghttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Comfortable CarvingPractice these simple stretches to enjoy carving for long periods of timeDon SwartzWHITSIP2021Fall202115Starter Guidecomfort exercisesstretches posturewhittling https://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Teaching Kids to WhittleSimple suggestions make it fun and easyMindy KinseyWHITSIP2021Fall202118Starter Guidewhittlingkid friendly carving teaching kidskids activitieshttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
''It Floats'' SailboatSoap whittling offers smooth sailing and good, clean fun for beginnersJanet BolyardWHITSIP2021Fall202119Starter Guidesoap carvingbeginner friendlykid friendlysailboat simplehttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Product Review: BeaverCraft Carving Kit for BeginnersIntroduce someone you love to the craft with this all-in-one box of cheerJames MillerWHITSIP2021Fall202125Starter Guidebeginner friendlycarvingkitswoodworkinghttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Avocado Pit OwlInstead of ditching your food waste, why not turn it into a unique piece of jewelry?Anna PrikazchikovaWHITSIP2021Fall202133Simple Whittlesavocadoowljewelry pendantfood carvinghttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Trick-or-Treater CaricatureTransform a basswood turning into an adorable work of art Lori DickieWHITSIP2021Fall202153Simple WhittlesHalloweencaricatureskeletontrick-or-treatkid friendlyhttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Balancing BirdsDefy gravity with this aerodynamic design Chris LubkemannWHITSIP2021Fall202156Simple Whittlesbirdsaerodynamic balancingflyingfreestandinghttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Sitting SquirrelCarve a cute backyard critter in just eight short stepsGene MesserWHITSIP2021Fall202160Simple Whittlessquirrelsimpleautumnbeginner friendlyhttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Flat-Plane CatCustomize this flat-plane feline in dozens of ways, so everyone gets the purr-fect giftTom HindesWHITSIP2021Fall202173Simple Whittlesflat planecatssimpleanimalshttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Tiny UnicornComplete this petite project in just seven steps Lieve RoelantsWHITSIP2021Fall202192Simple Whittlesanimalsunicornmagicalbeginner fairytalehttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Laid-Back LumberjackSpend your next camping trip making a character who loves wood as much as you doPeter JofsWHITSIP2021Fall202127Afternoon Carvesrusticcaricaturewoodlandcampingforestshttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Bird in a CageA few simple cuts turn a classic design into a showstopperDaniel BreedingWHITSIP2021Fall202137Afternoon Carveswhimsyanimals cardinalcaged birdhttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Simple TomteNo need to fret over eyes or hands on this beginner-friendly carve John Overby WHITSIP2021Fall202145Afternoon Carvesbeginner friendlyfolkloremythicalelvesmischievoushttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Chubby Stylized SealThis nautical creature is all smiles—and once you carve him, you will be, tooJames MillerWHITSIP2021Fall202149Afternoon Carvesnautical animals sealcartoonishhttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Snowman OrnamentThis cute caricature will make you want to deck the halls all year longSara BarracloughWHITSIP2021Fall202177Afternoon CarvessnowmancaricatureChristmas winterornamentshttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Alaskan FishermanBeat the heat with this beginner-friendly project Nikki ReeseWHITSIP2021Fall202181Afternoon CarvescaricaturefishermanAlaskabeginner friendlynauticalhttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Feather PendantCharm your favorite avian enthusiast with a piece of stunningly detailed jewelryGiles NewmanWHITSIP2021Fall202141Weekend Projectsjewelrypendantfeatherbirdsnaturehttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Matchbox Lake SceneFloat into vacationland with this tiny (but oh-so-detailed) dioramaSteve TomashekWHITSIP2021Fall202163Weekend Projectsminiaturedioramawildernessnatureanimalshttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Carving a Human FigureLearn to add movement and personality to caricatures with just a few cuts Dave StetsonWHITSIP2021Fall202167Weekend Projectscaricaturemovementfiguresposturenaturalhttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Celtic KnifeUse simple techniques to create an elaborate knotwork patternBob KozakiewiczWHITSIP2021Fall202185Weekend Projectsknifeceltic knotsletter openersimpleknotworkhttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Little VampireSink your teeth into this adorable carveAlex JoinerWHITSIP2021Fall202188Weekend Projectsvampirecaricaturehalloweentrick-or-treatscaryhttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Woodchips: Whittling LegendKentucky folk artist Minnie Adkins celebrates more than 80 years of woodcarvingCarroll, HannahWHITSIP2021Fall202196Featuresfolk artcaricaturesanimalslegendhttps://foxchapelpublishing.com/products/whittling-volume-7-2021?_pos=3&_sid=e46f21e1f&_ss=r&variant=48394064855321
Product Review: Hand in GloveWant to carve safely without compromising dexterity? Schaaf’s new cut-resistant gloves are just the ticket Staff97Winter202114Featuresglovestoolscarvingworkshop safetyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Birds of a FeatherCarvers provide comfort to communities one small, wooden bird at a timeNovosat, Lauren97Winter202181Featuresbirdsrelief comfortcommunitysimplehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Chip Carved SleighThe holidays can make for tricky terrain! Let this nostalgic vehicle carry you throughLeenhouts, Marty97Winter202129Patternschip carvingsleighSantaChristmasholiday decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Chicken SantaKris Kringle's winged friends may just change your carving experience forever Simpkins, Lee97Winter202174PatternsSantanontraditionalchickensanimalscaricaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Chip Carved BirdhousesThese old-world-style ornaments are a breeze to carve and assembleJenson, Jan97Winter202178Patternsbirdhouseornamentschip carvingbirdshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Workshop SantaHang out with Saint Nick as he adds the finishing touches before the big dayHammack, Chris97Winter202123ProjectsSantaworkshoptraditionaltoysChristmashttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
A Power Carved ReindeerPaint splatters and craft wire take this familiar animal to new heights Shrum, Edgar97Winter 202132Projectsreindeerpower carve holidaysanimalsRudolphhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Simple Snowman OrnamentGive Frosty a run for his money with this charming holiday classicKozakiewicz, Bob97Winter202137Projectssnowmanornamentsbeginner friendlyFrostyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Rustic Coffee ScoopMake your morning cup of joe even better with this elegant designRittenhouse, Josh97Winter202140Projectscoffeespoon carvingkitchen utensilscoopbreakfasthttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Wheely TurtleThis sweet twist on a kids’ staple might just “disappear” from the gift pile before Christmas morningBarraclough, Sara97Winter 202145Projectsturtlekidstoysgiftssimplehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Toy SoldierLet this colorful carve stand watch over all your presents on Christmas Eve nightKincade, Matt97Winter202149ProjectsChristmascaricaturesoldiertoysholiday decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Santa's HelperThis persnickety elf keeps the North Pole shipshapeReese, Nikki97Winter202155ProjectscaricatureelfSantaNorth PoleChristmashttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Carving Santa's Cousin PetuniaDon your party shoes and let this sassy character remind you that it’s five o’clock somewhereHammack, Chris97Winter202168ProjectsSantafamilyfestiveholidayswhimsicalhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Personalized Ribbon OrnamentPaint or woodburn the letters to make this fun bauble extra-special Gosnell, Dwayne97Winter 202186ProjectsornamentsSantapersonalizedribbonwoodburninghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Angel ReliefLet this lyrical carving bring joy to you and yours this holiday seasonCipa, Shawn97Winter202161Techniquesangelrelief carvingChristmasholiday decormusicalhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Woodchips: Deep FreezeBrothers Ross and Antonio Baisas leave crowds in awe of their beyond-cool ice sculpturesUmenhofer, Kelly97Winter202196Featuresice carvingice sculpturescompetitionsbrothersfamilyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-97-winter-2021
Product Review: Jonaker HatchetThis lightweight roughing hatchet is ideal for carvers on the goVoytas, Luke98Spring202218Featureshatchettoolsroughing outoutdoor projectgreenwoodhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Product Review: Tibro AxeUse this classic carpenter’s axe for anything—from building a house to shaping a spoonVoytas, Luke98Spring202220Featuresaxetoolscarpentryspoon carvingroughing outhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Knots and AllSophie Sellu’s practical sculpture celebrates natural shapes and quirky grain patternsSchofield, Kaylee98Spring202273Featuresspoon carving sculptingwood grainno wastenatural woodhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Chip Carved Celtic KnotElevate an array of objects with this twisting, turning designLeenhouts, Marty98Spring202253Patternschip carvingceltic knotsintermediatelidcoastershttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Cluster of ColumbinesWoodburn a lovely flower composition on a live-edge slab Mahoney, Shannon98Spring202255Patternswoodburning live edge woodflowersgeometricshadinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
The FarmerPay homage to the good old days with this advanced caricature Compton, Myron98Spring202279Patternscaricatureadvanced projectrusticagriculture countrysidehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Bittersweet Conversation HeartsThese super-easy shapes are a breeze to carve and colorStaff98Spring202287PatternsValentine's Daycandy heartsbeginner friendlyanniversarygiftshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Hammerin' HankThis cartoon handyman is great practice for incorporating carved add-onsApplegate, Kevin98Spring202225Projectscaricaturehandymanconstruction workerhome improvementcartoonishhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Dog and ButterflyWith big eyes and simplified features, this cute canine is a beginner carver’s dream Aniwat, Parn98Spring202229Projectsdogsbutterflycaricaturecolorfulbeginner friendlyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Man in the MoonMake a serene relief that evokes the night skyMay, Mary98Spring202232Projectsrelief carvingMoonnighttimecarving facesGoodnight Moonhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Bucktooth BirdSweeping cuts and subtle details give this silly bird plenty of sass Ankeny, Bruce98Spring202241Projectscaricaturebird carvinganimalsbirdhousescartoonishhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Carving a Jam KnifeFancy up your morning toast routine with a super-sleek wooden spreaderWelch, John98Spring202245Projectsknife carvingbutter knifewooden utensilskitchen utensilssilverwarehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Love BugCraft wire, movable parts, and splashes of paint bring this cute caricature to life Padden, Betty98Spring202248Projectsinsectscaricaturecraft wirenature springhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Gnome with BalloonsThis vivid character has a fun accessory in tow Czeladka, Miroslaw98Spring202257Projectsgnomescaricaturecolorfulballoonscraft wirehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Boisterous BunnyPower carve a charming mammal made of green wood Shrum, Edgar98Spring202261Projectspower carving Easter bunnyEaster eggspaintinganimalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Greenman PendantAdd a touch of earthy elegance to your jewelry collection with this statement pieceHrsak, Igor98Spring202265Projectsgreeman carvingjewelrypendantnaturecarving faceshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Super-Simple UnicornBring this fantastical animal to life in one sitting using just a knifeMiller, James98Spring202275Projectswhittlingunicornsmagicalmythicalrainbowhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Valentine's Day MonsterThis cute, customizable grump will melt your heart Canavan, Gerard98Spring202283ProjectscaricatureValentine's Daymonstercomical heartshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Fish Fin Measuring SpoonYou’ll flip for this one-of-a-kind kitchen utensilRigby, Emilie98Spring202290Projectsspoon carving measuring spoonfishtailsilverwarekitchen utensilshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Carving a Golf Ball CaricatureLearn to whittle stylized faces while clearing out your stash of spare golf ballsBarraclough, Sara98Spring202237Techniqueswhittlingcaricaturegolf ballscarving facesfigurinehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Stylized Koi FishNeodymium magnets, colored resin, and rich mahogany make for a Zen piece that’ll stop viewers in their tracks Caplinger, Daniel98Spring202268Techniqueskoi fishresincolorfulZennaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Woodchips: Sculpting in Joshua TreeCory Hamilton’s carved work straddles the line between startling and sereneCarroll, Hannah98Spring202296Featuresanimalsnaturepower carvingmetalmechanical https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-98-spring-2022
Schaaf's New Tool SetsTake your pick from three sets of hard-working hand tools that really hold an edgeIrish, Lora S. Staff99Summer202218Featurestoolscarvingchiselsgougesworkshophttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Razaire Mini X60 Smoke ExtractorUnit keeps your lungs safe and your pyrography workspace clear of smokeParsons, Michele99Summer202218Featurestoolswoodburning pyrographyworkshopsafetyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Lifelong Student From BAND-AID®s to the CCA, caricature carver Dwayne Gosnell reflects on his carving journeyCarroll, Hannah99Summer202277Featurescaricaturesanimalsartistcarving facesstudenthttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Carving a Flat-Plane CharacterThis Nordic-inspired piece is a study in creating dynamism with a single knifeBanks, Charles99Summer202250Techniquessailorcaricaturesnauticalflat planeNordichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Magnolia BlossomsLearn to create realism and drama in this deep relief carvingCoyne, Rosanna99Summer202285Techniquesmagnoliasrelief carvingflowers naturerealistichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Carving a Common KingfisherCreate the base for this bird with a real twigDe Bruijn, Wouter99Summer202223Projectsbirdsanimalssimplenaturetwighttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Tiny Carved GnomesComplete this simple, customizable figure in one sitting—and then make a whole army of them!Young, David99Summer202226Projectsgnomeswhittlingcaricaturesminiaturesimplehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Happy-Go-Lucky TurtleRoll into summer with this little reptileKuhar, Ken99Summer202231Projectsturtlecaricaturesanimalsreptilesbeachhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Carving a Flower BarretteThis relief carved accent holds a lot of hairGovaerts, Ivan99Summer202235Projectsjewelry hairpinflowersrelief carvingaccessorieshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Five-Point WhimseyWhittle a double star in just five working stepsBurgon, Garth99Summer202243Projectsstarwhimseywhittling geometrichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Stylized WhaleCarve this languid leviathan with just a few simple detailsAniwat, Parn99Summer202255Projectswhaleoceancaricaturesanimalssimplehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Classic Rosette ReliefHone your carving skills on this traditional Tudor-style reliefFox, Lucy99Summer202259Projectsflowersrelief carvingtudor roseclassictraditionalhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Mini DetectiveTake a bite out of crime with this small but powerful carveScalin, Karen99Summer202264ProjectscaricaturesdetectiveminiatureSherlock Holmescrimehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Scuttling CrabThis sweet crustacean will make you want to don your flip-flops and retreat to the beachVilkov, Evgeny99Summer202269Projectscrabsnauticalmagnetanimalscrustaceanhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Snorkeling GnomeChannel beachy vibes with this vacation-ready caricatureKincade, Matt99Summer202279Projectscaricaturesgnomesbeachpoolsnorkelinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Mr. VacationThis advanced carve is a one-way trip to paradiseLaramore, Wayne99Summer202239Patternsvacationadvancedcaricaturescolorfultropicalhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
The Dynamic TrioWoodburn a charming farm scene using just one tipStephenson, Don99Summer202246Patternswoodburningpyrography horsesanimalsrustichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Old-World PlaqueClean chip carved lines and a quilt-like pattern give the perfect balance of classic and modernJenson, Jan99Summer202274Patternschip carvingplaqueold world stylequiltclassichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Woodchips: Folk LureHandmade fishing lures turn a long-lost hobby into a family activity Deck, Jon99Summer202296Featuresfishing lureshandmadehooksbaithttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-99-summer-2022
Carved 100th Issue QuiltSee what readers did with a single 4'' square!Staff100Fall202216Featuresquiltquilt blockcontestchip carvingrelief carving https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Carving Community Roundup Check out this list of prominent groups who promote woodcarving Carroll, Hannah100Fall202220Featurescommunityclubs groups organizationrounduphttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
100 Tips from the Last 25 Years Consult these timeless tidbits from the WCI archivesSchofield, Kaylee100Fall202223Featurestipstechniquespainting finishing sandinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Wood-and-Resin Floating LeafCombine relief carving, epoxy, and paint for a winning tribute to the seasonMiller, D.L.100Fall202238Techniquesresinrelief carvingleaves autumnpaintinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
One Block, 64 FacesRotating facial features let you create a whole cast of characters in a single blankYou, Joe100Fall202253Techniquesfacescharacterscombinationsblock carvinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Carving Pumpkin HeadsTransform a simple egg blank into hundreds of different expressionsHiser, Jim100Fall202285TechniquesHalloweenpumpkinscaricaturesheadsjack-o'-lanternhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Gunslinger McCoyThis cowboy in motion has one mean stareHammack, Chris100Fall202232ProjectscaricaturecowboyLone RangerWild Westoutlawhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Cottage Incense BurnerThis cozy house sports whimsical colors and a working chimney Housefield, John100Fall202245Projectsincense burnercottagewhimsicalincense holderhome decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Ivy Leaf Sugar SpoonDial up your breakfast routine with this little carved showstopperDe Jager, Saskia100Fall202256Projectsspoon carvingsugarleaves scoopkitchen utensilhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Hanging Caricature BatThis fanged friend is cute enough to display all yearEmbling, Richard100Fall202259ProjectscaricatureHalloweenbatvampirespookyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Laid-Back GuyThis flat-plane piece is perfect practice for removing wood with confidenceBanks, Charles100Fall202269Projectshuman figurecaricaturesweater weatherflat planebookendhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Bridge Troll Impress your friends with a charming fairy-tale grumpReese, Nikki100Fall202274ProjectsHalloweentrollfairytale caricaturemythicalhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Chip Carved BoxStore little treasures in this nature-inspired keepsakeBaldina, Tatiana100Fall202279Projectsboxeschip carvingkeepsakestoragejewelry boxhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Easy Candy CornEnjoy a beginner-friendly “sweet” that won’t worry your dentistKozakiewicz, Bob100Fall202242Patternscaricaturecandy cornHalloween trick or treatcandyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Chip Carved Candle DishAdorn a simple vessel with repeating symbols of fallLynum, Charlene100Fall202251Patternscandlescandle holderchip carvinghome decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Whittle a Magic WandThis spellbinding (and simple) project is perfect for fantasy loversMiller, James Ray100Fall202264PatternswhittlingwandmagicalHarry PotterHalloweenhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Carved S'moreThis classic campfire treat will melt your heartJohnson, Kevin100Fall202267Patternssmorescaricaturesbonfirefirepit outdoorshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Mallard in FlightHeed the call of the wild in a colorful woodburned portraitIrish, Lora S.100Fall202283Patternswoodburningpyrographybirdsanimalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Woodchips: Winner Takes AllChampion pumpkin carver Ryan Anderson talks chainsaw carving tips, design inspiration, and what makes 1,500-lb pumpkins special Umenhofer, Kelly100Fall202296FeaturespumpkinscompetitionwinnerHalloweencontestanthttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-100-fall-2022
Basic Knife Cuts Master four foundational carving cuts so you can take on any projectStaffWHITSIP2022Fall20216Starter Guidetoolsknifebasicbeginner friendlyhttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Whittling SafetyThese basic rules can help prevent injuriesStaffWHITSIP2022Fall20228Starter Guidewhittlingknifesafetytoolshttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Knife Selection Follow these tips when selecting a folding knifeStaffWHITSIP2022Fall202210Starter Guideknifetoolswhittlingshop toolshttps://foxchapelpublishing.com/products/whittling-volume-8-2022
The Basics of SharpeningProperly prepare your knife for safe and enjoyable whittlingStaffWHITSIP2022Fall202212Starter Guidesafetyknifetoolsmaintenanceknife sharpeninghttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Comfortable CarvingPractice these common stretches to enjoy carving for long periods of timeSwartz, DonWHITSIP2022Fall20215Starter Guidecomfort exercisesstretches posturewhittling https://foxchapelpublishing.com/products/whittling-volume-8-2022
Teaching Kids to WhittleFor fun and easy learning, heed these simple suggestionsKinsey, MindyWHITSIP2022Fall202218Starter Guidewhittlingkid friendly carving teaching kidskids activitieshttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Hobby Knife Kits to TryWe tested four popular budget knife sets so you don’t have toSchofield, KayleeWHITSIP2022Fall202220Featuresknivestoolsshops carvinghttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Wingin' ItWhen life started throwing punches, caricature carver Sara Barraclough started making woodchips Carroll, HannahWHITSIP2022Fall202282Featurescaricatures cartoonishwhimiscalgolf ballshttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Heart-in-a-Cage WhimseyComplete this sweet take on a classic design in just five steps Roelants, LieveWHITSIP2022Fall202230Simple Whittleswhimsyminiatureheartsball in cage whittlinghttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Easy-Carve MagnetsThese simple shapes will add personality and charm to your refrigeratorAniwat, ParnWHITSIP2022Fall202241Simple Whittlesmagnetsflowerssnailsfishsimplehttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Avocado Pit CatRepurpose your food waste into an elegant piece of jewelryPrikazchikova, AnnaWHITSIP2022Fall202255Simple Whittlesavocado catsfood carvingvegetablesanimalshttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Thoughtful AngelWith only basic features, this winged whittle is a beginner’s dreamCristean, RoxanaWHITSIP2022Fall202259Simple Whittles angelbeginner-friendlysimplewire featurescaricaturehttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Making a Clover ChainTackle this take on the traditional carved chain in just eight stepsJespersen, BjarneWHITSIP2022Fall202272Simple Whittlescloverchainswhimsyluckyinterlockinghttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Miniature Twig TreeOnce you master this whittling technique, the possibilities are endlessLubkemann, ChrisWHITSIP2022Fall202275Simple WhittlestwigsChristmastreesornamentssnowmanhttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Momma Polar Bear and CubPractice the basic knife cuts as you build a wintry home for this cute duo Hindes, TomWHITSIP2022Fall202291Simple Whittles animalspolar bearswhittling simpleiceberghttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Soap PenguinThis cool character makes a great beginner projectBolyard, JanetWHITSIP2022Fall202294Simple Whittles soap carvingpenguinsanimalsdecorhttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Sven the SailorSail the high seas with this flat-plane characterMiller, James RayWHITSIP2022Fall202225Afternoon Carvescaricaturessailornauticalfishermancaptainhttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Whittling a SpurtleCreate a versatile kitchen utensil in an afternoonWelch, JohnWHITSIP2022Fall202233Afternoon Carveskitchenutensilskitchen decorcutleryhttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Leaping FoxTry your hand at carving miniatures with a sprightly critterTomashek, SteveWHITSIP2022Fall202237Afternoon Carvesfoxanimalsminiaturewhittlinghttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Bundled-Up Santa OrnamentThis rosy-cheeked Claus is great practice for cutting into corners Kozakiewicz, BobWHITSIP2022Fall202245Afternoon CarvesChristmasornamentsSanta Clausdecorationshttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Whittling a Dragon and EggA common lighter puts the finishing touches on this fiery creature Hellwig, AnnabellWHITSIP2022Fall202248Afternoon Carvesdragonpyrographywoodburningfairy talemythicalhttps://foxchapelpublishing.com/products/whittling-volume-8-2022
One-Knife SpoonTransform a block of basswood into a Celtic-inspired keepsakeWestern, DaveWHITSIP2022Fall202263Afternoon Carvesspoon carvingkitchenutensilscutlerywhittlinghttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Sliding Ball-in-CageMastered the basic whimsey? Take it up a notch with this new twist Hopson, BartWHITSIP2022Fall202287Afternoon Carveswhimsy ball in cagesimplewhittlinghttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Carving a Leaning FigureLearn how to add movement to carves with this dynamic project Stetson, DaveWHITSIP2022Fall202251Weekend Projectscaricaturehuman figuremovementnaturalhttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Scrappy SeagullCarve a feathered friend (and a perch for him to stand on) from one piece of woodRiggott, DanWHITSIP2022Fall202267Weekend Projectsseagullbeachanimalscaricaturesanimalshttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Laid-Back GuyRemove wood with confidence on this flat-plane piece Banks, CharlesWHITSIP2022Fall202277Weekend Projectshuman figurecaricaturesweater weatherflat planebookendhttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Woodchips: Tree or Tool?Dan Warther honors his woodcarver grandfather in giant pliers sculptureUmenhofer, KellyWHITSIP2022Fall202296Featurespliersfamily traditionlegacychainsaw carvingwhittlinghttps://foxchapelpublishing.com/products/whittling-volume-8-2022
Holiday Shopping GuideVirtual classes make a great gift for carvers at any skill level Schofield, Kaylee101Winter202219Featuresholidaysshopping gifts classesvirtualhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Hiding in Plain SightThomas Dambo creates gargantuan trolls from pallets and scrap woodCarroll, Hannah101Winter202283Featurestrollssculpturesgigantic woodsreclaimed woodhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Power Carved SnowmanBuild this smiling creature using just a few raw materialsShrum, Edgar101Winter202235Techniquessnowmanpower carvingChristmasdecorationsFrostyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
A Trio of Woodland OrnamentsWith a little burning and low relief carving, you can turn craft store rounds into works of artParsons, Michele101Winter202240Techniquesornamentswoodburning pyrographywoodlandanimalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Kindly Santa OrnamentPractice carving curls and hair texture with this rosy-cheeked caricature Harris, Tony Kozakiewicz, Bob101Winter202223ProjectsSanta ClausornamentsChristmasholidayscaricaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Flat-Plane Winter BirdCelebrate the understated beauty of the female cardinal with one knife and a little paintMiller, James Ray101Winter202229Projectscardinalanimalsbirdswintercaricaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Smiling Star Tree Topper“Light” this year’s tree by adding a beaming caricature on top Embling, Richard101Winter202245ProjectsstarChristmastree topperholidaysChristmas treehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Cookie Thief SantaEnjoy a snack break with this off-duty St. Nick Ankeny, Bruce101Winter202249ProjectscaricatureSanta ClausChristmas Evecookies holidayshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Carving an Atlantic PuffinCreate a stylized showstopper in just eight steps de Bruijn, Wouter101Winter202253Projectspuffinbirdscaricatureanimalswinterhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Christmas GnomesCarve these beginner-friendly guys with just three little tools Young, David101Winter202259ProjectsChristmasgnomes caricatureminiatureholidayshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Folk Art Polar BearPeaceful features combine with dramatic textures in a must-have winter carve Francis, Dave101Winter202264Projectspolar bearcaricatureholidaysChristmascaricaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Winter Cottage in Cottonwood BarkThis cozy woodland hideaway is a perfect introduction to bark carving Overcash, Kathy101Winter202269Projectscottagecottonwoodbarkwinterwoodlandhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Gnomes in PajamasCatch this pair of sleepy characters before they vanish for their winter nap! Reese, Nikki101Winter202279Projectsgnomespajamaswhimsicalnightimecaricaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Floppy Hat Santa OrnamentSame Santa, new duds—this easy carve is a recipe for successKozakiewicz, Bob101Winter202286ProjectsornamentsSanta ClausChristmasholidays festivehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Holly Berry EarringsCarve a pair of festive baubles—for your ears! Akane101Winter202243Patternsearringsjewelryholly berryChristmasholidays https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Chip Carved Bottle HolderImpress dinner guests with a gravity-defying pieceLeenhouts, Marty101Winter202260Patternschip carvingwine bottle holderChristmaspartieshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Chip Carved Mitten OrnamentsMimic the look of knitwear with a pair of carved “accessories” for the tree Lynum, Charlene101Winter202276PatternsornamentsChristmaschip carvingmittensdecorationshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Snowman Relief OrnamentCreate a clever holiday tableau using scrap wood and wirePadden, Betty101Winter202291PatternsChristmas snowmanFrostyornamentsholidayshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
A Tree to RememberTwo carving clubs come together annually to make ornaments for their local hospice centerUmenhofer, Kelly101Winter202296FeaturesdecorationsChristmasornamentsdonationscharityhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Chip Carved SnowflakesThese cookie-sized classics are sweeter than dessertNoller, Tom101Winter2022WEBPatternschip carvingsnowflakesornamentswinterholiday decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
The Carousel of HappinessVietnam War veteran carves and operates a merry-go-round to rememberCarroll, HannahNovosat, Lauren101Winter2022WEBFeaturescarouselwhimsicalamusementrideattractionhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-101-winter-2022
Everyday GenerosityAspen Golann’s love for traditional furniture craft blossomed into a project with legs Schofield, Kaylee102Spring202371Featureschairmakingfurniture workshoptoolboxclasseshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Fail-Safe Spoon Carving TipsFollow these wisdoms to create a safe, rewarding, and personalized carving practice Van Driesche, Emmet102Spring202387Featuresspoon carvingtipstechniquespracticesafetyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Wood Spirit BirdhouseThis practical piece adds humor to any backyard or pollinator sanctuaryHill, Chris102Spring202345Techniqueswood spiritnaturebirdhousesgarden decorspringhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Woodland Scene in ReliefLearn to achieve maximum depth with a tableau full of shadows and texturesStoner, Randall102Spring202365Techniquesrelief carvingforestwoodland creatureswoodsanimalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Carving a BluebirdHone your power-carving skills on this springtime songbird Conner, Randy102Spring202323Projectsbluebirdpower carvingbirdsanimalsrealistic https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Egg MouseTransform a basswood turning into a cute little critterKulp, Steve102Spring202334Projectsmouseanimalsbasswood eggegg carvingTom and Jerryhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Bearly FitsCreate a comical bear and tree from a single piece of woodGosnell, Dwayne102Spring202337Projectscaricaturebearsanimalscomicalnaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Winged Chain LinksThis twist on a carved classic will set your heart aflutterRoelants, Lieve102Spring202340Projectswhimseychainstattoowhittlingwingshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Caricature Biker Dude MagnetsExperiment with different personalities on this rough-and-tumble crew Worley, Don102Spring202353ProjectscaricaturemagnetsbikersmotorcyclesHarley Davidsonhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Little DuckWhittle a feathered friend in just six steps Cristean, Roxana102Spring202357Projectswhittlingminiatureducksanimalsbirdshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Woodburned BunnyA watchful rabbit stars in this lifelike pyro portraitHylton, Melanie Layne102Spring202360Projectswoodburningpyrographybunnyanimalsforestshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Fairy HouseBuild and paint a whimsical home that opens and shutsPadden, Betty102Spring202373Projectsfairy talemagicalmythicalfairieshome decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Sun and MoonUse inlay techniques to make a reversable pendantHrsak, Igor102Spring202383Projectspendantwooden jewelrysunmoonnaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Woodland Gnome OrnamentTry your hand at texturing and detailing without having to carve the whole bodyReese, Nikki102Spring202390Projectsgnomesornamentswoodland creaturemagicalmythicalhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Granny's in the GardenThis caricature shows how to make an impression using the art of oppositesRhadigan, Floyd102Spring202331PatternscaricaturegrandmagardeningcomicalPopeyehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Carved Easter EggsEasy, cute, and colorful, these starter projects are a great intro to shaping and detailingYoung, David102Spring202343PatternsEastereggsnatureholidaysspringhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Pencil HolderStore assorted office supplies in a classy chip carved containerLeenhouts, Marty102Spring202351Patternspencilsofficedesksupplieschip carvinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Cartoon ElephantsCarve a circus of easy pachyderms in under 30 minutesZanauskas, Pete102Spring202381Patternselephantsanimalscolorfulcartoonishcircushttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
The History of Romantic Spoon CarvingLovespoon carver shares the story behind a traditional token of affectionWestern, Dave102Spring2023WEBFeaturesspoon carvinglovespoonshistoryoriginslovehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-102-spring-2023
Summer Harvest BowlShare the season’s bounty with a stunning chip carved vessel Leenhouts, Marty103Summer202345Patternschip carvingbowlsfruit bowlinlayplateshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Lighthouse In-the-RoundMake a nautical novelty with a few pieces of basswoodMayer, Aaron and Andy103Summer202347Patternslighthousenauticalsummeroceanseasidehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Carving a Hot-Air BalloonPay tribute to a legendary mode of transport with this vivid little project Tas, Mehmet Berat103Summer202371Patternshot-air balloontransportationaircolorfullegendaryhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Honeybee ReliefChannel those summer vibes in a sweet ode to backyard pollinatorsFox, Lucy103Summer202340Techniquesrelief carvinghoneybeebeesbugsnaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Painting a Power-Carve BluebirdTexturing, layering, blending: this realistic flier is all about the detailsConner, Randy103Summer202377Techniquesbluebirdpaintingpower carvingbirdsanimalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Caricature Pirate CaptainPeg legs are so last season—and it looks like this seafarer just got an upgradeGosnell, Dwayne103Summer202327Projectspiratecaricatureparrotoceannauticalhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Carved SucculentsTurn Instagram’s favorite plant into a wooden desk sitter using just one knife! Young, David103Summer202333Projectsplantssuccelentsnaturesimplecactus https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Stylized NuthatchPerch this dynamic bird on a real tree branchde Bruijn, Wouter103Summer202351Projectsbirdsnaturaltree branchesdynamic animalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Tic-Tac-ToeBuild this classic game with some string and branches from your backyardEgholm, Frank and Lillian103Summer202357Projectsrusticgamesplaytimekidsoutdoorshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Whittled TurtleTransform a block of wood into a sea of woodchips in this cute projectHindes, Tom103Summer202360Projectswhittlingturtlescaricaturesoceannauticalhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Kelly the ClownThis colorful circus performer is sure to be the life of the partyKozakiewicz, Bob103Summer202363Projectsclowncaricaturecomicalcolorfulcircushttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Four-Point RibbonCreate a classic whimsey in just a few stepsBurgon, Garth103Summer202369Projectswhimseyribbonsimpleclassichttps://www.foxchapelpublishing.com/magazines/woodcarving-illustrated-issue-103-summer-2023-wci103.html
Uncle Sam Chip ClipCarve a patriotic addition to your pantryAkers, Mark103Summer202373ProjectscaricatureUmcle Samclip Fourth of Julypatriotichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Simple DinosaurTravel back to the Jurassic Period with a creature you can carve using just three tools Aniwat, Parn103Summer202383ProjectsdinosaurJurassic Parkcaricaturewhimsical colorfulhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Shaving Brush CaricaturePersonalize your beard-care routine with a handcarved handle Beane, Roger103Summer202387Projectscaricatureshavingbrushesgroomingbeardshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Choosing Wood for BeginnersNew to carving? Never fear! Here are the best materials for the jobDeck, Jon103Summer202317Featuresbeginnersbasswoodchoosing woodmaterialshttps://www.foxchapelpublishing.com/magazines/woodcarving-illustrated-issue-103-summer-2023-wci103.html
The Basics of SharpeningProperly prepare your knife for safe and enjoyable carvingStaff103Summer202319Featuressharpeningknivestoolstechniqueshttps://www.foxchapelpublishing.com/magazines/woodcarving-illustrated-issue-103-summer-2023-wci103.html
The Right Bench Knife for YouLooking for your first carving tool or a reliable upgrade? Check out these quality optionsStaff103Summer202321Featuresknivescarvingtoolsproduct reviewshttps://www.foxchapelpublishing.com/magazines/woodcarving-illustrated-issue-103-summer-2023-wci103.html
Teaching Kids to CarveThinking about bringing a child into the fold? Here are some things to consider Stowe, Doug103Summer202354Featureskidsbeginnersteachingwhittlinghttps://www.foxchapelpublishing.com/magazines/woodcarving-illustrated-issue-103-summer-2023-wci103.html
Simple CombGreat as a tool or a hair accessory, these projects are a cinch to shape and finishMcCaffrey, Keoma103Summer2023WEBPatternscombshairaccessorieshair pick brushhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-103-summer-2023
Power Carving BasicsGetting started power carving? Here are a few main things to considerStaffPC SIP23Summer202311Getting Startedbeginnerpower toolstipsrotary toolscarvinghttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Selecting the Right Power Carving EquipmentFollow these wisdoms to build your dream kitHamilton, DaveKochan, JackRussell, Frank and Chuck SolomonPC SIP23Summer202312Getting Startedtoolsequipmentbitsworkshophttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Choosing Power Carving BitsMake smart purchases with a basic understanding of the cutters availableHamilton, DaveSolomon, ChuckPC SIP23Summer202318Getting Startedpower carvingbitstoolstipsworkshophttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Tools for Removing Wood QuicklyWe test-drive the hardiest “toys” on the marketStaffPC SIP23Summer202323Getting Startedtoolsattachmentsgrindersequipmentspeedhttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Introduction to Reciprocating CarversBlend an edged-tool texture with the speed of a power carverStaffPC SIP23Summer202325Getting Startedbeginnerpower carvingtoolschiselstexturehttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Power Carving SafetyAnticipate potential dangers for a safer shop experienceHamilton, DaveKochan, JackRussell, Frank and Chuck SolomonPC SIP23Summer202327Getting Startedsafetyworkshopeye protectionmaskspower carvinghttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Dust Collection RoundupConsider these options for keeping your woodshop—and lungs—free of dustDeck, JonPC SIP23Summer202329Getting Startedworkshopsafetydust collectionventilationmaskshttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Cleaning and Maintaining BitsProlong the life of burrs with these quick hacksRussell, FrankPC SIP23Summer202333Getting Startedtoolsburrsbitsmaintenance cleaninghttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Woodburning TipsLearn why pyrography is a key skill to add to your arsenalStaffPC SIP23Summer202335Getting Startedwoodburningtoolspyrographytipstechniques https://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Airbrushing on the CheapYou could have two-thirds of an airbrush setup hiding in your workshop!Deck, JonPC SIP23Summer202337Getting Startedtechniquesfinishing paintingairbrushingaffordablehttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Micromotors: A Master ClassGet your hands on some tips and techniques for micromotor power carvingLeVier, KristinPC SIP23Summer202339Getting Startedmicromotortechniquespower carvingtoolsburrshttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Carolina WrenCarve a bird so lifelike it’ll make you do a double take Duncan, B. DavidPC SIP23Summer202345Projectswrenbirdsrealisticanimalswoodburninghttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Smoking Garden GnomeThis spunky character comes with a pipe and a whole lot of personalityShrum, EdgarPC SIP23Summer202352Projectscaricaturegnomewhimiscalmythicalchainsaw carvinghttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Crescent Moon WandMake a little magic for the fantasy fan in your lifeSeevers, TameraPC SIP23Summer202358ProjectswandfantasywizardHarry Pottermagicalhttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Three-Point RibbonCreate a classic wooden whimsy with just a rotary tool and a knife Burgon, GarthPC SIP23Summer202364Projectswhimsyrotary toolclassicbeginner friendlybasic cutshttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Hardwood MouseTransform colorful scraps into a cute little rodent on a bed of leaves Purnell, PaulPC SIP23Summer202367Projectsmouserealisticanimalsautumn leavesnatural finishhttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Ice Skate OrnamentAdd an unexpected embellishment to an easy holiday ornamentMcCaffrey, KeomaPC SIP23Summer202373Projectsornamentwinterice skatingvintageholidayshttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Tiny T. RexThis king of lizards will be a hit with dino lovers of all agesAltison, BrianPC SIP23Summer202375ProjectsdinosauranimalscaircatureJurassic ParkGodzillahttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Realistic Bear HeadMake this handsome beast without endless hours of fur texturingAndrews, LoriPC SIP23Summer202379Projectsbearanimalsbustrealisticfur texturehttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Carving the Female FaceMaster the technique of sculpting a human portraitHoward, ChrisPC SIP23Summer202385Projectstechniquefemale faceportraitssculptingbusthttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Power-Carved Pirate ShipIndulge your inner pirate by making a miniature Jolly Roger Tyler, BenjaminPC SIP23Summer202392ProjectspiratesshipminatureJolly Rogerkidshttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Realistic Tropical FishHone your fish-carving skills on a vibrant reef dweller Spencer, JamesPC SIP23Summer202395Projectstropicalfishanimalsvibrantrealistichttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Golden Eagle Walking StickDress up a functional cane with this glorious raptorPurnell, PaulPC SIP23Summer2023100Projectswalking stickeagleanimalsrealisticfunctionalhttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Autumn JewelrySculpt a lovely array of wearable acorns and leaves McCaffrey, KeomaPC SIP23Summer2023105Projectswooden jewelryacornsleavesautumnwearablehttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Making a Rustic Measuring CupPower carve a kitchen staple from salvaged wood Drake, DavidPC SIP23Summer2023107Projectsmeasuring cuplizardanimalsrustickitchenhttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Rolling Pin SantaUse a reciprocating carver to give old utensils a new faceGeorge, RandyPC SIP23Summer2023111Projectsrolling pinSantaChristmaskitchen utensilsrecyclehttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Great Horned OwlLet the chips fly where they may with this striking chainsaw sculptureRobinson, MichaelPC SIP23Summer2023113Projectschainsaw carvingowlbirdsanimalssculpturehttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Baby ChickadeeA little bird told us this is the perfect project for power carvers Clark, ButchPC SIP23Summer2023WEBProjectschickadeebirdsanimalsrealisticpaintinghttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Product Review: MakerX Rotary Tool and Airbrush ComboUnique power hub gives you the freedom to craft wood wherever the open road takes youStaffPC SIP23Summer2023WEBFeaturestoolspower carvingrotary toolairbrushingportablehttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Product Review: The Only Power Carver You'll Ever NeedThe new Foredom K.1060 delivers both power and precision—at a friendly priceStaffPC SIP23Summer2023WEBFeaturespower carvingtoolsmicromotorreviewaffordablehttps://foxchapelpublishing.com/products/power-carving-volume-5-2023?_pos=1&_psq=power&_ss=e&_v=1.0
Taking Your Painting to the Next LevelFollow these pro tips to make the coloring process ten times betterPadden, Betty Staff104Fall202314Featurespaintingtextureoil paintsfinishingtechniquehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Oakleaf Green LadyCreate a striking female face from cottonwood barkOvercash, Kathryn104Fall202353Techniquescottonwood barkfemale facenatureleavesrealistichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Midnight Pumpkin ReliefCarve and paint this showstopping harvest moon scenePadden, Betty104Fall202386Techniquesrelief carvingpumpkinsautumnHalloweenpaintinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
The Courting CoupleMake an affectionate flat-plane duo with just one knifeBanks, Charles104Fall202324Projectscaricaturewhittlingflat plane carvingromancecouplehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Flying Blob MonsterTransform a log into a funny figure from outer spaceShrum, Edgar104Fall202335Projectspower carvingmonsteralienHalloweenlog carvinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Flat-Plane KoalaCarve this cute little critter from Down UnderMiller, James104Fall202340Projectskoala caricatureflat plane carvinganimalsAustraliahttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Pilgrim TurkeyThis caricature is on a journey to become part of your harvest décor Kincade, Matt104Fall202345ProjectscaricatureThanksgivingturkeypilgrimholiday carvinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Easy PumpkinsThis little gourd is a one-knife wonderReese, Nikki104Fall202361Projectswhittlingflat plane carvingpumpkinsHalloweenautumnhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Man of the WoodsCarve a classic gnome that’s sure to make you smileCzeladka, Miroslaw104Fall202364Projectscaricaturelumberjackgnomewoodsmannaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Bark Fairy DoorWelcome some sprites to your garden with this little fantasy reliefLaycraft, Adria104Fall202369Projectsbark carvingfairiesnaturemythicalmagicalhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Extreme Ball-in-a-CageTake this classic whimsey to the next levelKozakiewicz, Bob104Fall202373Projectswhimseywhittlingball in cageclassichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Strainer SpoonElevate a cooked meal with this stylish hardwood utensilTremblay, Brad104Fall202377Projectsspoon carvingkitchen utensilhardwoodkitchen decorladlehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Stylized ScarecrowPractice combining individual pieces in this colorful assembly Aniwat, Parn104Fall202383ProjectscaricaturescarecrowHalloweenautumncornfieldhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
A Solve-All for ''Tool Sprawl''Make a basic caddy to hold your carving toolsFoster, Casey104Fall202330Patternsworkshoptoolsorganizationsafetycaddyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Autumn TreesThese little carves are bursting with fall colorYoung, David104Fall202333Patternstreesnatureautumnleavessimplehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Chip Carved Toothpick HolderTwo styles of vessel keep small items organizedLynum, Charlene104Fall202351Patternschip carvingtoothpicksmartiniskitchen holderhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Carved Owl ReliefThis high-contrast ornament is a perfect way to test your painting chopsMotovidlak, Jill104Fall202381Patternsrelief carvingornamentowlbirdsanimalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Easy Stacked PumpkinsHave fun carving a variety of facial expressions on these cute gourdsJohnson, Kevin104Fall2023WEBProjectscaricaturepumpkinsautumnHalloweengourdshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Ghost KidCelebrate the spirit of the season with a whimsical Fright Night carvingMellott, Tom104Fall2023WEBPatternsHalloweentrick or treatcandyghostsFright Nighthttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Wonders in WoodOver a thousand carvers gather and showcase their work at the annual Pennsylvania eventStaff104Fall2023WEBFeaturescarving showcontesteventexhibitionwhittlinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Deep Sea Jack-O'-LanternsScuba divers compete in a decades-old pumpkin carving contest in the Florida KeysStaff104Fall2023WEBFeaturespumpkin carvingscuba divingcompetitionoceanunderwaterhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-104-fall-2023
Beginner’s Guide to FinishesThere are many different approaches to finishing a carving—where to start? Here are some tipsStaff105Winter202316Featuresfinishespainting texturetechniques https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Carving the ClassicsMary May’s lush, old-world woodwork transports us to an elegant past Staff105Winter202395Featuresrelief carvingfeatureOld-World Styletechniqueshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Kirigami SnowflakeReimagine a classic childhood project—in wood!Bruillard, Paul105Winter202353Techniquessnowflakewood shavingspapercraftswinterhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Icicle OrnamentsChip carve 3D icicles with this easy-to-follow techniqueLynum, Charlene105Winter202375Techniquesornamentsiciclewinter3D chip carvinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Stylized Christmas Tree with OrnamentsCarve and trim this tree from the comfort of your workbenchKergan, Dave105Winter202327ProjectsChristmastreesdecorationsornamentshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
20-Minute Whittled WolfQuickly carve this woodland creature in a flat-plane styleHindes, Tom105Winter202331Projectswhittlingwolfanimalsflat-plane carvingwoodlandhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Stovepipe Hat SantaThis cool guy in a jaunty topper is stepping out for the holidaysFrancis, Dave105Winter202337ProjectsSanta ClausSt. Nickcaricatureholidayshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Waddling WallyLet this charming penguin keep you warm on a cold dayCanavan, Gerard105Winter202341ProjectspenguincaricatureanimalswinterAntarctica https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Mouse in a MittenStir up some sweetness with this quick and cute carveRangel, Robert105Winter 202345ProjectsornamentsmousemittenChristmasholiday decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Sound Asleep Santa OrnamentThis free-falling design is sure to land on your list of favorite winter baubles Stoddard, Rick105Winter202348ProjectsSanta ClausornamentsChristmaswinterhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Snowman CaricatureThis season, carve up a character who just can’t wait for the flurries to fallAnkeny, Bruce105Winter202359ProjectscaricaturesnowmanwinterChristmasholiday decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Geometric StarUse chip carving techniques to make a striking (and beginner-friendly) giftMay, Mary105Winter202367ProjectsoramentsstargeometricshapesChristmas treehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Easy Iceberg and PenguinsWhittle a sweet Antarctic scene using just a knife and some scrap woodParslow, L.P.105Winter202371ProjectswinterpenguinsicebergArctichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Lantern and Berries Layered OrnamentA warm candle lights the night in this cozy window scenePadden, Betty105Winter202380ProjectsornamentslanternChristmas treeholiday decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Tree Man OrnamentThis gnome-like caricature is a perfect first carving project Spencer, James105Winter202385Projectsgnomecaricaturetreesnatureornamentshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
After the Sleigh Ride Santa CaricatureSanta deserves a rest after his gift-giving spree wraps upAnkeny, Bruce105Winter 202321PatternsSanta ClauscaricatureChristmas St. Nickhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Stocking OrnamentsBundle up your Christmas tree with these cozy little chip-carved decorations Lynum, Charlene105Winter202324Patternschip carvingstockingsChristmas decorholidayshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Folk Art Farm AnimalsPut your own spin on these rustic barnyard beautiesMotovidlak, Jill105Winter202333Patternsornamentsanimalssheepcowroosterchickengoathttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Comfort RhinoQuiet your worries with a smooth creature that fits perfectly in your palmMellott, Tom105Winter202351Patternscomfort carvingrhinosanimalsgiftsstress reliefhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Singing Christmas TreesWho needs a barbershop quartet when you have a choir of expressive evergreens? Scott, Russell105Winter202363PatternsChristmas treebarbershop quartetholidays decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Simple Santa WhistleMake some noise for the holidays with this old-fashioned toyMartin, W. Todd105Winter202378Patternstoyskidsstocking stufferSanta Clauswhistleholidayshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Firefighter Caricature BustsStriking facial expressions and subtle paint washes bring this brave crew to lifeApplegate, Kevin105Winter202389Patternscaricaturesbustsfirefightersdecorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Woodburned Snowflake CoastersTurn your breakfast nook into a winter wonderland with these easy-to-make creationsRobinson, Minisa 105Winter2023WEBPatternscoasterswoodburnpyrographysnowflakeswinterhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-105-winter-2023
Magic TouchCecilia Schiller’s entertaining automata encourage interactionBolinski, Dorissa106Spring202495Featuresautomatonanimationgearsgizmosfeaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Power-Carved Eagle LogDifferent colors of wood from the same log make this bird of prey soarJohnson, Jordy106Spring202453Techniquespower carvingeaglebirdsanimalsloghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Making a Hook KnifeTreat your spoon projects to a handmade tool that’s inexpensive to construct Stowe, Doug106Spring202468Techniqueshook knifeknives handmadetoolsspoonshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Alphabetical Arboretum WoodcutFrom A to Z, these leaves make an attractive handmade printLewis, Beth106Spring202486Techniquesalphabetwoodcutprintmakinghandmadehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Stylish Leprechaun CaricaturePractice adding accessories with this swaggering man-about-town Tas, Mehmet Berat106Spring202419PatternsleprechauncaricatureSt. Patrick's DayluckyIrishhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Buckle Up!Fun and wearable carving might encourage some fish storiesKozakiewicz, Bob106Spring202437Patternsfishbelt buckleanimalswearablehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Chip Carved BraceletEasy bangle makes an impressive statement piece Lynum, Charlene106Spring202439Patternsjewelrybraceletschip carvingbanglehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
It's Elementary!Solve the riddle of capturing a caricature’s essence with this ode to Sherlock HolmesApplegate, Kevin106Spring202450PatternsSherlock Holmesbustcaricaturesdetectivesmysteryhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Butterfly and Flower PyrographyA clever coloring technique gives life to this organic wood burningLyon, Shannon106Spring202461Patternswoodburningpyrographybutterflyflowersnaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Desk ClockSet aside some time to chip carve this striking office accessoryLeenhouts, Marty106Spring202479Patternschip carvingclocksdesk decoroffice decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Realistic WalleyeWhopping trophy is a fisherman’s dreamWeiss, Charles106Spring202481Patternsrealistic carvingfishanimalsnaturewalleyehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Caricature-Chef Bottle StopperAdd some joie de vivre to your dinners with this quick and fun carveMartin, W. Todd106Spring202493Patternschefcaricaturebottle stopperkitchen decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Interlocking Heart ReliefSurprise your one-and-only with a piece of Celtic-inspired wall art Laughy, Lisa106Spring202423Projectsrelief carvingheartsValentine's DayCeltichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Carving a Leaf SpoonFinish this nature-inspired utensil with milk paint accentsWeber, Elizabeth106Spring202428Projectsspoon carvingleaf spoonkitchen utensilsnaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Stylized ShorebirdSmooth avian project puts the “sand” in “sanderling” de Bruijn, Wouter106Spring202433Projectsshorebirdbirdswhittlinganimalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Power-Carved BullfrogSculpt a full-size pond dweller so lifelike, you’ll expect him to ribbitDuncan, B. David106Spring202443Projectsbullfroganimalspower carvingwoodlandhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Balancing StonesFind your Zen with this easy branch whittling projectParslow, L.P.106Spring202448ProjectsstoneswhittlingZen simplehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
My Cat PearlThis cute calico caricature is ready to pounce Rhadigan, Floyd106Spring202457Projectscatanimalscariaturecalicohttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Flying DragonFlat-plane carving style lends a scaly look to this beast of loreAtkin, Dave106Spring202463Projectsdragoncaricaturemagicalmythicalhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Easy GnomeBuild your confidence with a simple face you don’t have to paintKeser, Birce106Spring202471Projectsgnomesimplemythicalwoodlandhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Soap RabbitQuickly carve a nest of bunnies to brighten any bathroomSone, Makiko106Spring202475Projectsrabbitanimalssoap carvingdecorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Chip Carved EarringsThese earthy baubles are so easy and satisfying to make, you might just fill a jewelry boxJenson, Jan106Spring2024WEBPatternsearringschip carvingOld-World Stylejewelryhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Leveling Up Your Relief CarvingsLearn about uncommon tools, ideal woods, and a game-changing techniqueSavarese, Joseph A.106Spring2024WEBTechniquesrelief carvingroseflowersValentine's Dayhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-106-spring-2024
Creating a Simple Carving StationEasily secure your project for two-handed carvingLaCasse, Alec107Summer202414Featurescarving stationtoolsworkshopworkspacehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
The Carver Behind Buffalo FluffaloMeet Erin Kraan, the woodcarver who illustrated a bestselling children’s book Staff107Summer202418Featureschildren's bookillustrationpicture bookfeaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
The Blind WoodsmanFor John Furniss, woodworking is more than just a hobby—it’s a lifeline Schofield, Kaylee107Summer202447Featuresdisabilitywoodworkinglifelonghobbyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Uncle Ham and the Patriotic PiggySpangle this simple caricature with stars and stripes to celebrate the 4thZanauskas, Pete107Summer202429Projectspatrioticpigs4th of Julyred, white, and bluehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Stylized BadgerTwo-toned paint blending brings out the beast in this little den dwellerde Bruijn, Wouter107Summer202435Projectsbadgeranimalswoodlandmammalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Celtic Knot GourdMetallic pigment over dark paint creates an illusion of antiquity for this folkloric vesselAvery, Jenn107Summer202420ProjectsgourdsCelticfolklorepaintinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Soup SpoonSatisfy your craving for the perfect carving challengeVan Driesche, Emmet107Summer202443Projectsspoon carvingkitchen utensilschallengehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Squirrel MonkeyCarve, sand, and paint a whimsical creature straight out of the jungle Tomashek, Steve107Summer202456Projectssquirrel monkeyanimalsminiaturecaricaturewhittlinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Uncle Sam Bottle StopperWelcome the summer holidays to your table with this expressive American standbyMartin, W. Todd107Summer202473ProjectsUncle Sampatriotic 4th of Julybottle stopperkitchen decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Carving a Sailboat in Shallow ReliefWelcome the summer holidays to your table with this expressive American standbyStrenke, Dustin107Summer202424Techniquessailboatrelief carvingnauticaltexture depthhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Nautical Birch BoxA secret lies beneath the waves of this charming sea-themed cannisterParslow, L. P. 107Summer202467Techniquesbirch boxnauticalwhalesailboattrinket boxkeepsake boxhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Tater's Last PitchHit it out of the park with this expressive, active, and highly detailed ballplayerLaramore, Wayne107Summer202419Patternsbaseballpitchercaricaturesportshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Floral PlatesUp your chip carving game with these breezy botanical designsLynum, Charlene107Summer202432Patternschip carvingfloralnatureplatesdecorativehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Little Dustpan CaricaturePractice adding funny details and expressions with this easy projectKuhar, Ken107Summer202438Patternsdustpanbroomcaricaturehousehold applianceshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Blue-Footed BoobyThis comical, dancing marine bird is sure to elicit some grins Mellott, Tom107Summer202450Patternsbirdscomicalanimalscaricatureshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Angling for FunReel in the perfect catch with this happy caricature fishermanHiser, Jim107Summer202453Patternsfishermancaricatureanglingsportshobbyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Chip Carved Soap DispenserDisguise a plain, utilitarian item with an attractive outer casingLeenhouts, Marty107Summer202459Patternschip carvingsoap dispenserbathroom decorkitchen decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Chillin' Penguin!Carve an unlikely beachgoer with a host of fun accessoriesOwens, Eric107Summer202462Patternspenguincaricaturebeachsummeranimalshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Barn and Silo PyrographyWoodburn a cozy yet challenging farm scene full of shadows and texturesWallace, Carol107Summer 202471Patternspyrographywoodburningbarnsilorusticlandscapehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Sleepy OwlOne-knife whittle is a perfect beginner projectMiller, James Ray107Summer2024WEBProjectsowlanimalscaricatureswoodlandhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-107-summer-2024
Getting SchooledTeaching dynamo Richard Embling shares his passion for woodcarving with students everywhereBolinski, Dorissa108Fall202457FeaturescaricaturesmonstersFrankensteinbeginnersteachingtipshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Haunted Statue CaricatureTry a scary texturizing technique for this ghostly guy McNulty, Jerry108Fall202425TechniquesHaunted Mansionstone statueHalloweenghostsgraveyardhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Autumn LighthouseSubtle washes of acrylic paint give life to a tranquil fall scene Stenman, Fred and Elaine108Fall202435Techniqueslow-relief carvinglighthousefall scenescenerynaturewoodburninghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Whittled Fantasy PencilGive a drab desk some personality with this quirky one-knife projectRoelants, Lieve108Fall202461Techniquespiratesalienswhittlingpencilsfantasyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Whitetail DeerPractice carving delicate appendages with this easy but measured designMiller, James Ray108Fall202417Projectsdeer animalsforestnaturewoodshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Oak Leaf and Acorn PendantCapture the beauty of nature within the fluid lines of this organic necklacePopovska, Slavica108Fall202422Projectsjewelrypendantnecklaceacornsleavesnaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Baxter the Ghoulish GourdWow your neighbors this Halloween with the coolest pumpkin on the blockCupp, Lundy108Fall202429Projectspumpkin carvingcaricaturesHalloweenjack-o'-lanterncarving faceshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Wood Spirit with Raven and WandConjure a magical man of the woods with a found log and some carving bitsShrum, Edgar108Fall202440Projectswood spiritslog carvingravenmagicalnaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Carving a Cherokee BearA stylized design and a good sanding really make this piece of cedar pop Smith, James ''Bud''108Fall202447ProjectsbearanimalsstylishcedarNative Americanhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Monster MagnetBring this funny mummy to life with strategic cuts and an eye on dimension Embling, Richard108Fall202454ProjectscaricaturesmonstersMummymagnetsHalloweenhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Glowing Soap GhostTurn a simple DIY soap into a cute spectral gatheringBolyard, Janet108Fall202459Projectssoap carvingglow in the darkghostsFrankensteingravestoneshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Tall Hat WizardAdd movement, shadow, and personality to your caricatures by removing a whole lotta woodFeather, Jim108Fall202467ProjectscaricaturewizardmagicalHarry Potterfantasyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Axe of StrengthProtect your favorite carving knife with a Viking-worthy blade cover Kelam, Nick108Fall202433Patternsblade coveraxeVikingsNordichttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Decorative Salad BowlTurn, texture, and color your own dinner party showstopperVoytas, Luke108Fall202451Patternsbowlsdecorationsaladkitchenbowl turninglathehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Ichabod's FlightCarve and stylize a folk-art figurine that looks like a rustic heirloomMotovidlak, Jill108Fall202463PatternsSleepy HollowIchabod CraneHalloweenfolk artfigurineHeadless Horsemanhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
5-Point Star RosetteAcrylic paint and gel stain add flair to an easy chip-carved coasterLeenhouts, Marty108Fall202473Patternschip carvingcoastersstarsimplerosettehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Agatha the WitchGluing layers prior to carving adds dimension for spellbinding resultsPadden, Betty108Fall202475PatternswitchHalloweenHocus Pocusspookyspellshttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Herman from MinnesotaCarve a little football fan who’s ready for the coldScalin, Karen108Fall2024WEBProjectscaricatureminiaturefootball seasonsports fanhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
A Happy AccidentRichard Shaw uses mixed media elements to create one-of-a-kind sculpturesUmenhofer, Kelly108Fall2024WEBFeatureschip carvingsculpturesbirdsfishmetalsteampunkhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-108-fall-2024
Carving Up in ColoradoWoodchips fly at the annual Carvin' the Rockies showBolinski, Dorissa109Winter202410Featureseventcarving showColoradocaricaturesclubhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Carved Christmas WreathStrategic layering and undercutting lend depth to a festive decoratioMay, Mary109Winter202444TechniquesChristmaswreathdecorativeholidaysfestivehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Santa's Journey HomeStars light the way for a weary St. Nick whose work is doneGreen, Dale109Winter202414ProjectscaricatureSantasChristmasfigurineNorth Polehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Black-capped ChickadeeA found branch adds a touch of the natural world to a minimalist carvingde Bruijn, Wouter109Winter202427Projectschickadeebirdsfound woodtree branchminiaturehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
The Gift BearerWelcome a friendly mouse to your house for the holidaysKincade, Matt109Winter 202439ProjectscaricaturemouseanimalsChristmaspresentsfestiveholiday decor https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Christmas Pickle OrnamentHave a chuckle searching the tree for this hiding pranksterCreason, Johnathan109Winter202448ProjectsornamentsChristmaspickletraditiondecorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Stumbling SantaA sense of movement highlights this animated clumsy SantaRangel, Robert109Winter202452ProjectscaricaturesSantacomedic holidaysfigurinehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Winter Barn SceneCarve and paint a rustic winter landscape that’s easier than it looksStadtlander, Robert109Winter202458Projectsrelief carvingrusticwinterbarn scenelandscapehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Candle ChoirAdd expressive character with easy shading and highlighting techniquesPadden, Betty109Winter202464Projectscaricatureschoircarolingcandlesholiday decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Undercover SantaThis jolly guy has a green thumb and a lesson to teachScott, Russell109Winter202472ProjectsSantacaricaturegardeninggreen thumbhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Retro Christmas OrnamentCarve a string of festive holiday lights that will never shatter or burn outDoty, Brian K.109Winter202422PatternsornamentsChristmas lightsdecorationsholiday decorhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Chip Carved Dala HorseFrolicking folklore design makes a charming decorationLynum, Charlene109Winter 202424Patternshorsesornamentschip carvingfolklorehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Christmas Mornin' BearThis sleepy guy had a long night wrapping presentsWetherbee, Rich109Winter202430PatternscaricaturebearChristmas morninganimalscomedic https://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Steampunk SantaStylish fantasy Santa is ready for a sci-fi adventureHarris, Tony109Winter202434PatternsSantacaricaturesteampunkgearsdecorativehttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Wine RackShowcase a wine bottle and glasses with a chip-carved displayLeenhouts, Marty109Winter202456Patternsbottle holderwine bottleschip carvingwine rackwine glassesholiday partyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Easy Christmas TreeStuff some stockings with these tiny topiariesYoung, David109Winter202470PatternsChristmas treeholidaysminiaturesimplebeginner friendlyhttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Carving PeaceSome battle-weary warriors are finding comfort through woodworkingBolinski, Dorissa109Winter2024WEBFeaturesPTSDtherapeuticcomfortveteranshealinghttps://foxchapelpublishing.com/products/woodcarving-illustrated-issue-109-winter-2024
Tree CharmerCarole Jean Boyd combines multiple styles in her imaginative carvingsBolinski, Dorissa110Spring202510Featureswood spiritstreescypress kneenature
Comfort HeartsCarve a pocket full of cheer with these sweet ValentinesLynum, Charlene110Spring202544Patternschip carvingheartsValentine's Daylovekeepsakes
Chip-Carved CrossIntricate cuts create a reverent masterpieceLeenhouts, Marty110Spring202572Patternschip carvingcrossBibleEasterreligion
Folk Art RobinThe early bird gets the worm with this Americana-inspired pieceWilson, Brooks110Spring202516Projectsrobinbirdsanimalsfreestandingfolk art
Bad Hair DaySpring weather came in like a lion for this guyApplegate, Kevin110Spring202521Projectscaricaturemovementhairtexture
Valentine GnomesEnhance the charm of this cute couple with folksy paintingCristean, Roxana110Spring202526ProjectsValentine's Daycouplegnomescaricatureheartlove
Goofy Golf BallsHit a hole in one practicing expressions with these fun carvesHarris, Tony110Spring202530Projectsgolfwhimsicalcaricaturesports
Hidden GreenmanA mysterious woodland character lurks in found woodLaCasse, Alec110Spring202533Projectsgreenmanwoodlandwood spiritcottonwood bark
First DateCreate a sense of movement with posture in this wistful characterMcNulty, Jerry110Spring202538Projectscaricaturemovementwhimsicaldate nightlove
Flat-Plane VikingCarve a sea-faring caricature with just a few toolsMiller, James Ray110Spring202546ProjectsVikingscaricatureMiddle Agesmedieval
Climbing SquirrelAdd interest to your yard with a beginner-friendly chainsaw carvingDrozd, Pawel110Spring202551Projectschainsawbeginnersquirrelanimalswoodland
Whimsical MushroomHone your symmetry skills with this one-knife projectReese, Nikki110Spring202557Projectscaricaturemagicalmushroomnaturefungiwhittling
Swizzle StickThis comical wizard could use a little magicHammack, Chris110Spring202560ProjectswizardcaricaturemagicMerlinHarry Potter
Sleek BunnyHop to it with a smooth rabbit carvingMellott, Tom110Spring202566Projectsrabbitanimalskeepsakesgiftstherapy
Chickadee in Acorn NestBring the outdoors in with a flock of tiny bird carvingsTomashek, Steve110Spring202576Projectsminiaturechickadeebirdsnatureacorn
Cup and SaucerAdd depth to shallow relief carvingsMay, Mary110Spring202568Techniquesrelief carvingteacupcoffeetea timedepth
Infinity CrossCarve intricate loops and braids to create a holy keepsakeDrazkowski, Dennis110Spring2025WEBPatternscrossBibleabstractmovement
Think SharpBehind the blade with Flexcut's product manager Matt RetkowskiBolinski, Dorissa111Summer202511FeaturesFlexcutknivestoolsbladesmanufacturingproduct
Peace, ManFollow this guy to the biggest festival of the summerAnkeny, Bruce111Summer202516PatternscaricatureWoodstockpeace signHippieGrateful Dead
Classic GnomeWalk in the enchanted forest with this friendly little characterTas, Mehmet Berat111Summer202535Patternsgnomescaricaturewhimsicalenchantedfolklore
Magical SeahorseCarve an elegant decoration that’s sure to please any fan of the open seaKeser, Birce111Summer202544Patternsseahorseoceananimalsnauticaldriftwood
Wacky Blade CoverThis funny tool guard will protect your favorite knifeAkers, Mark111Summer202551Patternscaricaturecomicalknivesbladestoolsprotection
Hummingbird and CraneSoar above the clouds with miniature birds in flightTomashek, Steve111Summer202560Patternsornamentsminiaturehummingbirdcranebirdsanimals
Crop Circles FrameUse a burr meant for roughing out to carve a textured designLeVier, Kristin111Summer202562Patternspicturetextureframecirclesgeometric
Realistic Atlantic SalmonReel in a trophy fish that looks like the real thingWeiss, Charles111Summer202565Patternssalmonfishrealisticoceannauticalmovement
Celtic Chip CarvingCreate a wall hanging or decorate a box lid with an ancient designChampagneur, Blandine111Summer202570Patternschip carvingCelticIrelandancientcultural
Salty Sea CaptainEmbark on a high seas adventure with a friendly seafaring gentCreason, Jonathan111Summer202522Projectscaricaturemagnetsea captainnauticaloceanhigh seas
Happy HopperThis charming fishing frog is ready to star in his own fairy taleWang, Alice111Summer202525Projectsfroganimalsfishingfairytalestorybook
Diamond RosettesTake chip carving to the next level with four unique geometric designsRocha, Nikolas111Summer202532Projectschip carvinggeometricdiamondrosetteintermediate
Walking FarmerGet a groove on and put some movement into your carvingsLunsford, Blake111Summer202538ProjectsfarmercaricaturemovementOld McDonaldcountry
Sunflower StarburstCatch the summer sun in a medium relief carving that exudes happinessStrenke, Dustin111Summer202546Projectsrelief carvingsunflowerflowers plantsnature
Easy DolphinWhittle a sweet, pocket-sized sea mammalHindes, Tom111Summer202573Projectsdolphinanimalswhittlingoceannautical
Mustache ManCurve the centerline to add interest and a natural flow to carvingsDion, Dave111Summer202554Techniquescaricaturemovementtexturemustachehair